R: 500 / I: 110
Brace through the hyper-real lacanian void together!
Reminder That None of This Is Real!™
ɢʀᴀʙ ᴀ ᴘᴀɪʀ ᴏꜰ sᴘᴇᴄᴛᴀᴄʟᴇs
—————————————————–
CORE THEORY
>The Society of the Spectacle (1967) by Guy Debord
📖 • https://www.marxists.org/reference/archive/debord/society.htm
📺 • https://www.youtube.com/watch?v=0blWjssVoUQ
<The Work of Art in the Age of Mechanical Reproduction (1936) by Walter Benjamin
📖 • https://www.marxists.org/reference/subject/philosophy/works/ge/benjamin.htm
📺 • https://www.youtube.com/watch?v=blq9sCIyXgA
>The Culture Industry from Dialectic of Enlightenment (1944) by Theodore Adorno & Max Horkheimer
📓 • https://www.marxists.org/reference/archive/adorno/1944/culture-industry.htm
📖 • https://libcom.org/article/dialectic-enlightenment-philosophical-fragments-theodor-adorno-and-marx-horkheimer
📺 • https://www.youtube.com/watch?v=5hSLdd8R8mY
<Understanding Media (1964) by Marshall McLuhan
📖 • https://designopendata.wordpress.com/wp-content/uploads/2014/05/understanding-media-mcluhan.pdf
📺 • https://www.youtube.com/watch?v=09ML9n5f1fE
>One-Dimensional Man (1964) by Herbert Marcuse
📖 • https://libcom.org/article/one-dimensional-man-studies-ideology-advanced-industrial-society-herbert-marcuse
📺 • https://www.youtube.com/watch?v=9ZCoLbEkAqs
<Discipline and Punish (1975) by Michel Foucault
📖 • https://theanarchistlibrary.org/library/michel-foucault-discipline-and-punishment
📺 • https://www.youtube.com/watch?v=s82uU4iRuko
>Simulacra and Simulation (1981) by Jean Baudrillard
📖 • https://libgen.is/book/index.php?md5=DBF3E860993373223D72E98FADF0F2DC
📺 • https://www.youtube.com/watch?v=1Yxg2_6_YLs
<Manufacturing Consent (1988) by Edward S. Herman & Noam Chomsky
📖 • https://libcom.org/article/manufacturing-consent-political-economy-mass-media-noam-chomsky-and-edward-s-herman
📺 • https://www.youtube.com/watch?v=34LGPIXvU5M
>The Sublime Object of Ideology (1989) by Slavoj Zizek
📖 • https://libgen.is/book/index.php?md5=054E022C8BD24EE2C5595B575BCED7DC
📺 • https://www.youtube.com/watch?v=TtIckkHsUQ4
<Postscript on the Societies of Control (1990) by Gilles Deleuze
📖 • https://theanarchistlibrary.org/library/gilles-deleuze-postscript-on-the-societies-of-control
📺 • https://www.youtube.com/watch?v=Hu4Cq_-bLlY
>Postmodernism, or, the Cultural Logic of Late Capitalism (1991) by Fredric Jameson
📖 • https://libgen.is/book/index.php?md5=5BD20E0E22FC8BC2CB4F8A7760D57027
📺 • https://www.youtube.com/watch?v=_4k26xGx1zI
<Spectres of Marx (1993) by Jacques Derrida
📖 • https://libcom.org/library/specters-marx-jacques-derrida
📺 • https://www.youtube.com/watch?v=TJr0NwXWb6Q
>Capitalist Realism (2009) by Mark Fisher
📖 • https://libcom.org/article/capitalist-realism-mark-fisher
📺 • https://www.youtube.com/watch?v=6Cb5XJH4NMI
—————————————————–
SUPPLEMENTARY MATERIAL
>Precursor Material to Post-modernity and Critical Theory
📖 • Karl Marx - Book 1, Chapter 4 of Economic and Philosophic Manuscripts (1844)
https://www.marxists.org/archive/marx/works/1844/manuscripts/labour.htm
📺 • Why Marx Was Right: Alienation - PlasticPills
https://www.youtube.com/watch?v=gPRxxN4Kh30
📖 • Georg Lukács - Chapter 4 of History and Class Consciousness (1923)
https://www.marxists.org/archive/lukacs/works/history/hcc05.htm
📺 • Marxism After Marx: Reification - The Marxist Project
https://www.youtube.com/watch?v=uZiI-QKxBKI
📖 • Antonio Gramsci - Book 1, Chapter 1 of Selections from the Prison Notebooks (1929)
https://www.marxists.org/archive/gramsci/prison_notebooks/problems/intellectuals.htm
📺 • Hegemony: WTF? An introduction to Gramsci and cultural hegemony - Tom Nicholas
https://www.youtube.com/watch?v=-LI_2-qsovo
📖 • Louis Althusser - Ideology and Ideological State Apparatuses (1970)
https://www.marxists.org/reference/archive/althusser/1970/ideology.htm
📺 • Althusser's Concept of Ideology: A Discussion with Anthony Gavin - Acid Horizon
https://www.youtube.com/watch?v=gtOqXxkKwvw
<Documentaries
• The Society of the Spectacle (1974) by Guy Debord
https://www.youtube.com/watch?v=mjF6I6SYjgA
• Manufacturing Consent (1992) by Mark Achbar & Peter Wintonick, with Noam Chomsky
https://www.youtube.com/watch?v=Li2m3rvsO0I
• The Pervert's Guide to Cinema (2006) and The Pervert's Guide to Ideology (2012) by Sophie Fiennes, with Slavoj Zizek
https://www.youtube.com/watch?v=FYuI4SFw4g0
https://www.youtube.com/watch?v=oBcFLmu_tlc
• HyperNormalisation (2016) by Adam Curtis
https://www.youtube.com/watch?v=4bv3Tr3jvZM&rco
>Easy-Bake Breadtube (for absolute beginners)
• We're All Fake Now - Wisecrack
https://www.youtube.com/watch?v=RTW1mPOJJ_Y
• Are Cell Phones Replacing Reality? - PBS Idea Channel
https://www.youtube.com/watch?v=8AXIAM7dTTg
• The Cultural Significance of Cyberpunk - Cuck Philosophy
https://www.youtube.com/watch?v=Nvor7hhDKTs
• Introduction to Critical Theory for the 21st Century - Nathan Dufour
https://www.youtube.com/watch?v=e7stVZPGxIw
• The Work of Art in the Age of Surveillance Capitalism - Brendan Morris
https://www.youtube.com/watch?v=aNKiBJJFXZI
<Situationist Archives
• https://situationist.org/
• https://notbored.org/SI.html
• https://bopsecrets.org/SI/index.htm
—————————————————–
RECOMMENDED OP-EDS
• I Don’t Want to Be an Internet Person by Ginevra Davis
https://www.palladiummag.com/2022/11/04/i-do-not-want-to-be-an-internet-person/
• Pluralistic: Tiktok's enshittification by Cory Doctorow
https://pluralistic.net/2023/01/21/potemkin-ai/#hey-guys
• Facebook's Threads is so depressing by Jason O. Gilbert
https://jogblog.substack.com/p/facebooks-threads-is-so-depressing
/ISG/ - Internet Spectacle General
A thread focused on discussing the parasocial relationships cultivated by the Almighty Algorithm to generate profit off of our atomization and society's commodification of petty internet drama.Brace through the hyper-real lacanian void together!
Reminder That None of This Is Real!™
ɢʀᴀʙ ᴀ ᴘᴀɪʀ ᴏꜰ sᴘᴇᴄᴛᴀᴄʟᴇs
—————————————————–
CORE THEORY
>The Society of the Spectacle (1967) by Guy Debord
📖 • https://www.marxists.org/reference/archive/debord/society.htm
📺 • https://www.youtube.com/watch?v=0blWjssVoUQ
<The Work of Art in the Age of Mechanical Reproduction (1936) by Walter Benjamin
📖 • https://www.marxists.org/reference/subject/philosophy/works/ge/benjamin.htm
📺 • https://www.youtube.com/watch?v=blq9sCIyXgA
>The Culture Industry from Dialectic of Enlightenment (1944) by Theodore Adorno & Max Horkheimer
📓 • https://www.marxists.org/reference/archive/adorno/1944/culture-industry.htm
📖 • https://libcom.org/article/dialectic-enlightenment-philosophical-fragments-theodor-adorno-and-marx-horkheimer
📺 • https://www.youtube.com/watch?v=5hSLdd8R8mY
<Understanding Media (1964) by Marshall McLuhan
📖 • https://designopendata.wordpress.com/wp-content/uploads/2014/05/understanding-media-mcluhan.pdf
📺 • https://www.youtube.com/watch?v=09ML9n5f1fE
>One-Dimensional Man (1964) by Herbert Marcuse
📖 • https://libcom.org/article/one-dimensional-man-studies-ideology-advanced-industrial-society-herbert-marcuse
📺 • https://www.youtube.com/watch?v=9ZCoLbEkAqs
<Discipline and Punish (1975) by Michel Foucault
📖 • https://theanarchistlibrary.org/library/michel-foucault-discipline-and-punishment
📺 • https://www.youtube.com/watch?v=s82uU4iRuko
>Simulacra and Simulation (1981) by Jean Baudrillard
📖 • https://libgen.is/book/index.php?md5=DBF3E860993373223D72E98FADF0F2DC
📺 • https://www.youtube.com/watch?v=1Yxg2_6_YLs
<Manufacturing Consent (1988) by Edward S. Herman & Noam Chomsky
📖 • https://libcom.org/article/manufacturing-consent-political-economy-mass-media-noam-chomsky-and-edward-s-herman
📺 • https://www.youtube.com/watch?v=34LGPIXvU5M
>The Sublime Object of Ideology (1989) by Slavoj Zizek
📖 • https://libgen.is/book/index.php?md5=054E022C8BD24EE2C5595B575BCED7DC
📺 • https://www.youtube.com/watch?v=TtIckkHsUQ4
<Postscript on the Societies of Control (1990) by Gilles Deleuze
📖 • https://theanarchistlibrary.org/library/gilles-deleuze-postscript-on-the-societies-of-control
📺 • https://www.youtube.com/watch?v=Hu4Cq_-bLlY
>Postmodernism, or, the Cultural Logic of Late Capitalism (1991) by Fredric Jameson
📖 • https://libgen.is/book/index.php?md5=5BD20E0E22FC8BC2CB4F8A7760D57027
📺 • https://www.youtube.com/watch?v=_4k26xGx1zI
<Spectres of Marx (1993) by Jacques Derrida
📖 • https://libcom.org/library/specters-marx-jacques-derrida
📺 • https://www.youtube.com/watch?v=TJr0NwXWb6Q
>Capitalist Realism (2009) by Mark Fisher
📖 • https://libcom.org/article/capitalist-realism-mark-fisher
📺 • https://www.youtube.com/watch?v=6Cb5XJH4NMI
—————————————————–
SUPPLEMENTARY MATERIAL
>Precursor Material to Post-modernity and Critical Theory
📖 • Karl Marx - Book 1, Chapter 4 of Economic and Philosophic Manuscripts (1844)
https://www.marxists.org/archive/marx/works/1844/manuscripts/labour.htm
📺 • Why Marx Was Right: Alienation - PlasticPills
https://www.youtube.com/watch?v=gPRxxN4Kh30
📖 • Georg Lukács - Chapter 4 of History and Class Consciousness (1923)
https://www.marxists.org/archive/lukacs/works/history/hcc05.htm
📺 • Marxism After Marx: Reification - The Marxist Project
https://www.youtube.com/watch?v=uZiI-QKxBKI
📖 • Antonio Gramsci - Book 1, Chapter 1 of Selections from the Prison Notebooks (1929)
https://www.marxists.org/archive/gramsci/prison_notebooks/problems/intellectuals.htm
📺 • Hegemony: WTF? An introduction to Gramsci and cultural hegemony - Tom Nicholas
https://www.youtube.com/watch?v=-LI_2-qsovo
📖 • Louis Althusser - Ideology and Ideological State Apparatuses (1970)
https://www.marxists.org/reference/archive/althusser/1970/ideology.htm
📺 • Althusser's Concept of Ideology: A Discussion with Anthony Gavin - Acid Horizon
https://www.youtube.com/watch?v=gtOqXxkKwvw
<Documentaries
• The Society of the Spectacle (1974) by Guy Debord
https://www.youtube.com/watch?v=mjF6I6SYjgA
• Manufacturing Consent (1992) by Mark Achbar & Peter Wintonick, with Noam Chomsky
https://www.youtube.com/watch?v=Li2m3rvsO0I
• The Pervert's Guide to Cinema (2006) and The Pervert's Guide to Ideology (2012) by Sophie Fiennes, with Slavoj Zizek
https://www.youtube.com/watch?v=FYuI4SFw4g0
https://www.youtube.com/watch?v=oBcFLmu_tlc
• HyperNormalisation (2016) by Adam Curtis
https://www.youtube.com/watch?v=4bv3Tr3jvZM&rco
>Easy-Bake Breadtube (for absolute beginners)
• We're All Fake Now - Wisecrack
https://www.youtube.com/watch?v=RTW1mPOJJ_Y
• Are Cell Phones Replacing Reality? - PBS Idea Channel
https://www.youtube.com/watch?v=8AXIAM7dTTg
• The Cultural Significance of Cyberpunk - Cuck Philosophy
https://www.youtube.com/watch?v=Nvor7hhDKTs
• Introduction to Critical Theory for the 21st Century - Nathan Dufour
https://www.youtube.com/watch?v=e7stVZPGxIw
• The Work of Art in the Age of Surveillance Capitalism - Brendan Morris
https://www.youtube.com/watch?v=aNKiBJJFXZI
<Situationist Archives
• https://situationist.org/
• https://notbored.org/SI.html
• https://bopsecrets.org/SI/index.htm
—————————————————–
RECOMMENDED OP-EDS
• I Don’t Want to Be an Internet Person by Ginevra Davis
https://www.palladiummag.com/2022/11/04/i-do-not-want-to-be-an-internet-person/
• Pluralistic: Tiktok's enshittification by Cory Doctorow
https://pluralistic.net/2023/01/21/potemkin-ai/#hey-guys
• Facebook's Threads is so depressing by Jason O. Gilbert
https://jogblog.substack.com/p/facebooks-threads-is-so-depressing
R: 12 / I: 0
>While exiled in 1899, Bauman had an affair with the wife of a fellow revolutionary who became pregnant with Bauman's child. Bauman responded by openly mocking her, and circulating a vicious cartoon of her as the Virgin Mary with a baby in her womb, with a caption asking "who the baby looked like". The woman later hanged herself.
>This story had gained wide currency among Russian political exiles by the time Bauman reappeared in Switzerland in 1902, after the escape from Kiev. Some of those involved in producing Iskra, including Lenin's closest friend and collaborator, Julius Martov and Pavel Axelrod, one of the founders of Russian Marxism, wanted Bauman expelled from the organisation. In 1903, the board of Iskra adjudicated the matter, and Lenin interceded on Bauman's behalf. According to biographer Robert Service, Lenin rejected the party's right to interfere, arguing that the party's task "was to make revolution against the Romanov monarchy and to vet the morality of comrades only when and in so far as their actions affected the implementation of the task". The subsequent controversy divided the party, and has been described as "one of the many personal clashes which came to define the ethical distinctions" between the Bolshevik and Menshevik factions after 1903.
Was it really worth it to split the party over this asshole?
>While exiled in 1899, Bauman had an affair with the wife of a fellow revolutionary who became pregnant with Bauman's child. Bauman responded by openly mocking her, and circulating a vicious cartoon of her as the Virgin Mary with a baby in her womb, with a caption asking "who the baby looked like". The woman later hanged herself.
>This story had gained wide currency among Russian political exiles by the time Bauman reappeared in Switzerland in 1902, after the escape from Kiev. Some of those involved in producing Iskra, including Lenin's closest friend and collaborator, Julius Martov and Pavel Axelrod, one of the founders of Russian Marxism, wanted Bauman expelled from the organisation. In 1903, the board of Iskra adjudicated the matter, and Lenin interceded on Bauman's behalf. According to biographer Robert Service, Lenin rejected the party's right to interfere, arguing that the party's task "was to make revolution against the Romanov monarchy and to vet the morality of comrades only when and in so far as their actions affected the implementation of the task". The subsequent controversy divided the party, and has been described as "one of the many personal clashes which came to define the ethical distinctions" between the Bolshevik and Menshevik factions after 1903.
Was it really worth it to split the party over this asshole?
R: 1 / I: 0
Cracked InDesign
Hey /tech/ I'm tryna get the cracked version of Adobe InDesign on my Macbook M1 cause im a brokie who doesn't want spend their limited resources on a sleezy company. Any tips or pointers?
R: 0 / I: 0
Honestly why do I feel unhappy in the Capitalist system, but yet rivarly, money-making for the sake of making money, dog-eat-dog situation were so normalized to me. ANd I'm arguing against my mother and at times my father over the fact "I'm not able to make money".
If I'm not able to make money, I'm called "the welfare queen" and such, at least here in Poland and called someone akin to a s*bhuman.
Talk me out of it, I feel terrible, my mental health took a toll, finally.
I get bullied about this very fact.
Is money root of evil?
I'm from Poland. I noticed how much I want to make money from music and from jobs I make. But I'm also starting to notice how money breaks famillies down. I noticed how I'm becoming unhappy with being groomed to only pursue money, if no then they call me a "dirty commie".Honestly why do I feel unhappy in the Capitalist system, but yet rivarly, money-making for the sake of making money, dog-eat-dog situation were so normalized to me. ANd I'm arguing against my mother and at times my father over the fact "I'm not able to make money".
If I'm not able to make money, I'm called "the welfare queen" and such, at least here in Poland and called someone akin to a s*bhuman.
Talk me out of it, I feel terrible, my mental health took a toll, finally.
I get bullied about this very fact.
R: 127 / I: 29
Previous: >>2365683
—————————————————–
Evidence of the influence and origin of neo-Nazi groups in Ukraine
https://archive.ph/44B9Q
https://archive.ph/x1sRT#1323637
https://archive.ph/x1sRT#1323658
https://archive.ph/x1sRT#1323663
https://archive.ph/x1sRT#1323688
https://archive.ph/x1sRT#1323729
https://archive.ph/x1sRT#1323733
https://archive.ph/x1sRT#1323731
https://archive.ph/x1sRT#1323735
https://archive.ph/x1sRT#1323740
—————————————————–
ALWAYS APPROACH SOURCES CRITICALLY
Live maps and updates
DeepStateMap: https://deepstatemap.live
Events in Ukraine: https://eventsinukraine.substack.com/
SouthFront: https://southfront.press/category/all-articles/world/europe/ukraine/
Watch Together
📺 News/events: https://tv.leftypol.org/r/HappeningsviaKlash
📺 Hangout/chill: https://tv.leftypol.org/r/bloodcast
Watch By Yourself
>Video Essays / Historical Background
📺 • Ukraine: The Avoidable War - Boy Boy
https://www.youtube.com/watch?v=LL4eNy4FCs8
📺 • Ukraine's Nazi Problem - The Marxist Project
https://www.youtube.com/watch?v=4yZvWAwU5W4
📺 • America, Russia, and Ukraine's Far Right - Gravel Institute
https://www.youtube.com/watch?v=t0pyVJG7_6Q
📺 • The Nature of Putin's Russia and Its Causes (3-Part Series) - 1Dime
https://www.youtube.com/watch?v=o8d6Vzi7zYg
https://www.youtube.com/watch?v=zODWTfMwFGw
https://www.youtube.com/watch?v=2Zuygh9Mzuo
<Current Happenings
📺 • The Grayzone: https://www.youtube.com/@thegrayzone7996
📺 • DDGeopolitics: https://www.youtube.com/@DDGeopolitics
📺 • Defense Politics Asia: https://www.youtube.com/@DefensePoliticsAsia
📺 • The Duran: https://www.youtube.com/channel/UCdeMVChrumySxV9N1w0Au-w
📺 • The News Atlas: https://www.youtube.com/c/thenewatlas
📺 • Military Summary: https://www.youtube.com/@militarysummary
—————————————————–
Social media
>Twitter
https://twitter.com/GeromanAT
https://twitter.com/plnewstoday
https://twitter.com/RALee85
https://twitter.com/MarQs__
https://twitter.com/KofmanMichael
https://twitter.com/IntelCrab
https://twitter.com/michaelh992
https://twitter.com/Suriyakmaps
<Telegram
https://t.me/milinfolive
https://t.me/hueviykharkov
https://t.me/conflictzone
https://t.me/vorposte
https://t.me/intelslava
https://t.me/grey_zone
https://t.me/AussieCossack
https://t.me/asbmil
https://t.me/Slavyangrad
🇷🇺🇺🇦
Thread guidelines:
• Please remember to add a spoiler to NSFW and extreme content such as graphic violence and gore.
• Try your best to not derail discussion too much from the main events and relevant places where the war is taken place, as well as other happenings, groups and public figures related to it.
• Meta discussion of the historical, philosophical and ideological background of the war is fine as long as its done in good faith and comradely.
• In the event the meta discussion overstays its welcome, participating users will be referred to take the conversation to the INTERNATIONALISM general thread.
• Quality shitposting and original content is encouraged! Spamming glowie memes is low effort.
• this is /isg/ for people who treat geopolitics like shitty map games.
• Slam dunk a NATO baby, etc.
/ukr/ - Russia-Ukraine War General #245
Israel edition.Previous: >>2365683
—————————————————–
Evidence of the influence and origin of neo-Nazi groups in Ukraine
https://archive.ph/44B9Q
https://archive.ph/x1sRT#1323637
https://archive.ph/x1sRT#1323658
https://archive.ph/x1sRT#1323663
https://archive.ph/x1sRT#1323688
https://archive.ph/x1sRT#1323729
https://archive.ph/x1sRT#1323733
https://archive.ph/x1sRT#1323731
https://archive.ph/x1sRT#1323735
https://archive.ph/x1sRT#1323740
—————————————————–
ALWAYS APPROACH SOURCES CRITICALLY
Live maps and updates
DeepStateMap: https://deepstatemap.live
Events in Ukraine: https://eventsinukraine.substack.com/
SouthFront: https://southfront.press/category/all-articles/world/europe/ukraine/
Watch Together
📺 News/events: https://tv.leftypol.org/r/HappeningsviaKlash
📺 Hangout/chill: https://tv.leftypol.org/r/bloodcast
Watch By Yourself
>Video Essays / Historical Background
📺 • Ukraine: The Avoidable War - Boy Boy
https://www.youtube.com/watch?v=LL4eNy4FCs8
📺 • Ukraine's Nazi Problem - The Marxist Project
https://www.youtube.com/watch?v=4yZvWAwU5W4
📺 • America, Russia, and Ukraine's Far Right - Gravel Institute
https://www.youtube.com/watch?v=t0pyVJG7_6Q
📺 • The Nature of Putin's Russia and Its Causes (3-Part Series) - 1Dime
https://www.youtube.com/watch?v=o8d6Vzi7zYg
https://www.youtube.com/watch?v=zODWTfMwFGw
https://www.youtube.com/watch?v=2Zuygh9Mzuo
<Current Happenings
📺 • The Grayzone: https://www.youtube.com/@thegrayzone7996
📺 • DDGeopolitics: https://www.youtube.com/@DDGeopolitics
📺 • Defense Politics Asia: https://www.youtube.com/@DefensePoliticsAsia
📺 • The Duran: https://www.youtube.com/channel/UCdeMVChrumySxV9N1w0Au-w
📺 • The News Atlas: https://www.youtube.com/c/thenewatlas
📺 • Military Summary: https://www.youtube.com/@militarysummary
—————————————————–
Social media
https://twitter.com/GeromanAT
https://twitter.com/plnewstoday
https://twitter.com/RALee85
https://twitter.com/MarQs__
https://twitter.com/KofmanMichael
https://twitter.com/IntelCrab
https://twitter.com/michaelh992
https://twitter.com/Suriyakmaps
<Telegram
https://t.me/milinfolive
https://t.me/hueviykharkov
https://t.me/conflictzone
https://t.me/vorposte
https://t.me/intelslava
https://t.me/grey_zone
https://t.me/AussieCossack
https://t.me/asbmil
https://t.me/Slavyangrad
🇷🇺🇺🇦
Thread guidelines:
• Please remember to add a spoiler to NSFW and extreme content such as graphic violence and gore.
• Try your best to not derail discussion too much from the main events and relevant places where the war is taken place, as well as other happenings, groups and public figures related to it.
• Meta discussion of the historical, philosophical and ideological background of the war is fine as long as its done in good faith and comradely.
• In the event the meta discussion overstays its welcome, participating users will be referred to take the conversation to the INTERNATIONALISM general thread.
• Quality shitposting and original content is encouraged! Spamming glowie memes is low effort.
• this is /isg/ for people who treat geopolitics like shitty map games.
• Slam dunk a NATO baby, etc.
R: 3 / I: 0
I think I have an heterosexual "black power" fetish. Im a white man, im not even murrikan, but I have fantasies of african-american women humiliating me racially and enslaving me\ sexual-themed torture or just plainly torturing me.
IRL im not racist, but not "militantly" anti-racist either frankly. I feel proud of my race to a normal level, and don't like being humiliate or mistreated in general really. Am I going schizo?
I think I have an heterosexual "black power" fetish. Im a white man, im not even murrikan, but I have fantasies of african-american women humiliating me racially and enslaving me\ sexual-themed torture or just plainly torturing me.
IRL im not racist, but not "militantly" anti-racist either frankly. I feel proud of my race to a normal level, and don't like being humiliate or mistreated in general really. Am I going schizo?
R: 388 / I: 87
Live news feed: refer to the title
USS Nimitz tracker:
https://www.marinevesseltraffic.com/vessels/USS-Nimitz-(CVN-68)/CURRENT-POSITION/1/303981000
Tracker of all military aircraft with active transponders. Focus mostly on the refueler and cargoe planes operated by Western states:
https://globe.adsbexchange.com/?lat=30&lon=42&zoom=4&mil
Previous Threads Archives:
https://archive.is/8x0dn
https://archive.is/1NdNy
https://archive.is/YmvG7
https://archive.is/ei9VS
https://archive.is/H68n0
https://archive.is/Z86D9
https://archive.is/d95ZP
https://archive.is/RRvVJ
https://archive.is/2CwGF
https://archive.is/eGAA7
https://archive.is/DYK68
https://archive.is/rMMRu
https://archive.is/2SqYn
https://archive.is/AbKAl
https://archive.is/gVvBb
https://archive.is/SnQtW
https://archive.is/LPcO4
https://archive.is/0Kial
https://archive.is/vuD3X
https://archive.is/nCs0B
https://archive.is/jMRdT
https://archive.is/rRJqN
https://archive.is/8OYAl
https://archive.is/7oRyr
https://archive.is/0z2Bu
https://archive.is/dLy0Y
https://archive.is/Q3xxZ
https://archive.is/ZddVd
https://archive.is/fCeCO
https://archive.is/v8JX7
https://archive.is/14Zfp
https://archive.is/AcfYS
https://archive.is/qkjDO
https://archive.is/JY4lA
https://archive.is/1wQwa
https://archive.is/DAYpv
/Iran-Israel/ General #40
It fizzled editionLive news feed: refer to the title
USS Nimitz tracker:
https://www.marinevesseltraffic.com/vessels/USS-Nimitz-(CVN-68)/CURRENT-POSITION/1/303981000
Tracker of all military aircraft with active transponders. Focus mostly on the refueler and cargoe planes operated by Western states:
https://globe.adsbexchange.com/?lat=30&lon=42&zoom=4&mil
Previous Threads Archives:
https://archive.is/8x0dn
https://archive.is/1NdNy
https://archive.is/YmvG7
https://archive.is/ei9VS
https://archive.is/H68n0
https://archive.is/Z86D9
https://archive.is/d95ZP
https://archive.is/RRvVJ
https://archive.is/2CwGF
https://archive.is/eGAA7
https://archive.is/DYK68
https://archive.is/rMMRu
https://archive.is/2SqYn
https://archive.is/AbKAl
https://archive.is/gVvBb
https://archive.is/SnQtW
https://archive.is/LPcO4
https://archive.is/0Kial
https://archive.is/vuD3X
https://archive.is/nCs0B
https://archive.is/jMRdT
https://archive.is/rRJqN
https://archive.is/8OYAl
https://archive.is/7oRyr
https://archive.is/0z2Bu
https://archive.is/dLy0Y
https://archive.is/Q3xxZ
https://archive.is/ZddVd
https://archive.is/fCeCO
https://archive.is/v8JX7
https://archive.is/14Zfp
https://archive.is/AcfYS
https://archive.is/qkjDO
https://archive.is/JY4lA
https://archive.is/1wQwa
https://archive.is/DAYpv
R: 3 / I: 0
4channers talk a big game as critics and consumers of art, but the vast majority of creative works that have come out of 4chan have been hot fucking garbage. Literally every popular /x/ creepypasta sucks.
4channers talk a big game as critics and consumers of art, but the vast majority of creative works that have come out of 4chan have been hot fucking garbage. Literally every popular /x/ creepypasta sucks.
R: 332 / I: 76
<51st State Edition
Thread for the hellish discussion related to the scourge of the earth, the destroyer of nations, the king of coups, the sultan of sanctions, the emir of the embargo, the autocrat of austerity, the doge of deregulation, the baron of busting unions, the prince of privatization, the lord of loan sharks, the patron-saint of proxy wars, the sponsor of settlers, the guarantor of genocides, the Divided $nakkkes of Amerikkka™
🏈 💵 🌭 🍔
🛠️ Strike Tracker ⚒️
https://striketracker.ilr.cornell.edu/
🇺🇸 Deeds of the Burger Reich 🇺🇸
https://github.com/dessalines/essays/blob/main/us_atrocities.md
📺 Live News 📺
(sponsored by USAID)
• CNN: https://www.livenewsnow.com/american/cnn-news-usa.html
• MSNBC: https://www.livenewsnow.com/american/msnbc.html
• FOX: https://www.livenewsnow.com/american/fox-news-channel.html
• Bloomberg: https://www.bloomberg.com/live/us
✊ Live Protest Streams ✊
https://woke.net/
Epstein's Client List DOES NOT EXIST
https://epsteinsblackbook.com/
Previous Thread: >>2378062
/USApol/ 🇺🇸
🗽UNITED STATES POLITICS 🦅<51st State Edition
Thread for the hellish discussion related to the scourge of the earth, the destroyer of nations, the king of coups, the sultan of sanctions, the emir of the embargo, the autocrat of austerity, the doge of deregulation, the baron of busting unions, the prince of privatization, the lord of loan sharks, the patron-saint of proxy wars, the sponsor of settlers, the guarantor of genocides, the Divided $nakkkes of Amerikkka™
🏈 💵 🌭 🍔
🛠️ Strike Tracker ⚒️
https://striketracker.ilr.cornell.edu/
🇺🇸 Deeds of the Burger Reich 🇺🇸
https://github.com/dessalines/essays/blob/main/us_atrocities.md
📺 Live News 📺
(sponsored by USAID)
• CNN: https://www.livenewsnow.com/american/cnn-news-usa.html
• MSNBC: https://www.livenewsnow.com/american/msnbc.html
• FOX: https://www.livenewsnow.com/american/fox-news-channel.html
• Bloomberg: https://www.bloomberg.com/live/us
✊ Live Protest Streams ✊
https://woke.net/
Epstein's Client List DOES NOT EXIST
https://epsteinsblackbook.com/
Previous Thread: >>2378062
R: 261 / I: 195
Also post Teto
Post Here Every time You Visit This Board
Post here every time you visit the board.Also post Teto
R: 72 / I: 83
the body was too round and fluffy
the body was too round and fluffy
the body was too round and fluffy
the body was too round and fluffy
Cat thread
Post cats, big n’ smallthe body was too round and fluffy
the body was too round and fluffy
the body was too round and fluffy
the body was too round and fluffy
R: 3 / I: 1
MAGAbros.. what's going on? What happened? This is not good MAGAbros, not good at all. Just look at all of this stuff that Drumpf hasn't accomplished that he said he would. I guess he was just lying the whole time to get more power, huh?
MAGAbros.. what's going on? What happened? This is not good MAGAbros, not good at all. Just look at all of this stuff that Drumpf hasn't accomplished that he said he would. I guess he was just lying the whole time to get more power, huh?
R: 26 / I: 4
Obviously I couldn't include every single nation/people fighting for liberation in this picture. It would've been especially hard to include the hundreds of indigenous nations of North & South America and Oceania. But their struggle matters too, and they too deserve freedom, justice and total liberation from imperialism and settler colonialism.
Liberation for all oppressed and colonized nations!
none of us are free until we're all free.Obviously I couldn't include every single nation/people fighting for liberation in this picture. It would've been especially hard to include the hundreds of indigenous nations of North & South America and Oceania. But their struggle matters too, and they too deserve freedom, justice and total liberation from imperialism and settler colonialism.
R: 16 / I: 2
https://www.swartzentrover.com/cotor/E-Books/misc/Livy/HOR_38.htm
I was under the impression that racism came with European colonialism of the Americas. But this quote from a Roman orator reads unironically like some Hitlerite speech.
How old is racism really?
<And, besides, those ancestors of ours had to deal with genuine Gauls bred in their own land; these are degenerates, a mongrel race, truly what they are called - Gallograeci. Just as in the case of fruits and cattle, the seed is not so effective in keeping up the strain as the nature of the soil and climate in which they are reared are in changing it.https://www.swartzentrover.com/cotor/E-Books/misc/Livy/HOR_38.htm
I was under the impression that racism came with European colonialism of the Americas. But this quote from a Roman orator reads unironically like some Hitlerite speech.
R: 567 / I: 88
How do I cope?
I don't want to live in a defeated Europe.
I don't think my psyche could handle witnessing the EU collapse or be reduced to an irrelevant institution by far right """reforms""". But that is just the outcome that is becoming increasingly more likely with each passing year.How do I cope?
R: 217 / I: 9
Is the fact that the Scandinavian countries have some of the strictest immigration laws in the world a form of social murder?
I’m autistic, queer and chronically ill. I currently live in America and am petrified of being a victim of eugenics. The Trump administration has made it clear they do not want me or any of my other autistic comrades to exist. RFK will soon move forward in finding a way to eradicate autistics. Same thing with queer people. The big bill that was just passed also cuts Medicare, which is crucial to my survival.
Since I’m unable to work a real job or be politically active in the streets due to my autistic and disabled identities my best option would be taking refuge in one of the Scandinavian countries. I’m particularly drawn to Iceland and Finland. All Scandinavian countries have some of the best healthcare in the world. They have the best benefits and aid for disabled and chronically ill people in the world. Very mutual aid-based cultures. And they’re basically autistic utopias since Scandinavians don’t do small talk, are very quiet and reserved, and don’t look people in the eye when they talk. Their languages are also very direct and much less ambiguous. They’re also very solitary people. I know society is what disabled me so if I could move to a Scandinavian country my disabilities would no longer be a problem and I’d be free.
But Scandinavian countries have some the the tightest immigration restrictions in the world. They don’t allow refugees fleeing from wars in so of course they won’t allow autistic comrades fleeing eugenics in. I’m fucking livid about it. Moving to Iceland, Finland or any other Scandinavian country is my only hope and the only hope of millions of other autistics in America. We are literally on the verge of being exterminated and yet we still can’t take refuge in the only countries that can save us.
So does this count as social murder, as Engels says?
Is the fact that the Scandinavian countries have some of the strictest immigration laws in the world a form of social murder?
I’m autistic, queer and chronically ill. I currently live in America and am petrified of being a victim of eugenics. The Trump administration has made it clear they do not want me or any of my other autistic comrades to exist. RFK will soon move forward in finding a way to eradicate autistics. Same thing with queer people. The big bill that was just passed also cuts Medicare, which is crucial to my survival.
Since I’m unable to work a real job or be politically active in the streets due to my autistic and disabled identities my best option would be taking refuge in one of the Scandinavian countries. I’m particularly drawn to Iceland and Finland. All Scandinavian countries have some of the best healthcare in the world. They have the best benefits and aid for disabled and chronically ill people in the world. Very mutual aid-based cultures. And they’re basically autistic utopias since Scandinavians don’t do small talk, are very quiet and reserved, and don’t look people in the eye when they talk. Their languages are also very direct and much less ambiguous. They’re also very solitary people. I know society is what disabled me so if I could move to a Scandinavian country my disabilities would no longer be a problem and I’d be free.
But Scandinavian countries have some the the tightest immigration restrictions in the world. They don’t allow refugees fleeing from wars in so of course they won’t allow autistic comrades fleeing eugenics in. I’m fucking livid about it. Moving to Iceland, Finland or any other Scandinavian country is my only hope and the only hope of millions of other autistics in America. We are literally on the verge of being exterminated and yet we still can’t take refuge in the only countries that can save us.
So does this count as social murder, as Engels says?
R: 329 / I: 682
please please please please please please please please
post porn post porn post porn post porn
please please please please please please please please
post porn
post porn post porn post porn post pornplease please please please please please please please
post porn post porn post porn post porn
please please please please please please please please
R: 9 / I: 0
Is it immoral to invest in the stock market?
I've been thinking of buying stocks, futures, and maybe even gold with the few laborbux that I can spare. I want to build up some kind kind of wealth that I can fall back on if I'm ever unemployed for some time or if I have an emergency. Is it immoral by leftist standards to invest in the stock market or is it okay?
R: 6 / I: 1
the fucks happening to twitter man
b,ody odjdjeu ebehejejrjejejeudiodpw0qpq9qw9w9q9qq99w9dudhdhdhdhdhdhjsawwwwwwwŵa huuyyuuuyyytt566777aaaaaaa
the fucks happening to twitter man
b,ody odjdjeu ebehejejrjejejeudiodpw0qpq9qw9w9q9qq99w9dudhdhdhdhdhdhjsawwwwwwwŵa huuyyuuuyyytt566777aaaaaaa
R: 63 / I: 24
Http://www.netherchan.org
Netherchan
I made a dutch speaking image board because my life does not have enough problems and I'm too weak to smoke meth.Http://www.netherchan.org
R: 363 / I: 83
Too short or empty Subedition
Still too short or empty Subsubedition
uygha are you fucking serious get your shit together mods its a fucking random board, you expect me to write a novel every time I want to make a thread Subsubsubedition
Previous thread: >>677469
Sex and Relationship General 48
Summer romance EditionToo short or empty Subedition
Still too short or empty Subsubedition
uygha are you fucking serious get your shit together mods its a fucking random board, you expect me to write a novel every time I want to make a thread Subsubsubedition
Previous thread: >>677469
R: 43 / I: 2
Incels are men with undiagnosed BPD. Not saying misogyny is a medical issue, but incels specifically are BPDs who are undiagnosed due to the shrink industry/institutions being misogynistic.
Incels are men with undiagnosed BPD. Not saying misogyny is a medical issue, but incels specifically are BPDs who are undiagnosed due to the shrink industry/institutions being misogynistic.
R: 17 / I: 3
who do you think has the biggest cock?
cockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcock
who do you think has the biggest cock?
cockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcock
R: 218 / I: 70
Links:
Previous Thread Archives
Thread 1 https://archive.ph/ROnpO
Thread 2 https://archive.ph/f29Po
Youtube Playlists
Anwar Shaikh - Historical Foundations of Political Economy
https://www.youtube.com/playlist?list=PLTMFx0t8kDzc72vtNWeTP05x6WYiDgEx7
Anwar Shaikh - Capitalism: Competition, Conflict and Crises
https://www.youtube.com/playlist?list=PLB1uqxcCESK6B1juh_wnKoxftZCcqA1go
Anwar Shaikh - Capitalism
https://www.youtube.com/playlist?list=PLz4k72ocf2TZMxrEVCgpp1b5K3hzFWuZh
Capital Volume 1 high quality audiobook from Andrew S. Rightenburg (Human-Read, not AI voice or TTS voice)
https://www.youtube.com/playlist?list=PLUjbFtkcDBlSHVigHHx_wjaeWmDN2W-h8
Capital Volume 2 high quality audiobook from Andrew S. Rightenburg (Human-Read, not AI voice or TTS voice)
https://www.youtube.com/playlist?list=PLUjbFtkcDBlSxnp8uR2kshvhG-5kzrjdQ
Capital Volume 3 high quality audiobook from Andrew S. Rightenburg (Human-Read, not AI voice or TTS voice)
https://www.youtube.com/playlist?list=PLUjbFtkcDBlRoV5CVoc5yyYL4nMO9ZJzO
Theories of Surplus Value high quality audiobook from Andrew S. Rightenburg (Human-Read, not AI voice or TTS voice)
https://www.youtube.com/playlist?list=PLUjbFtkcDBlQa-dFgNFtQvvMOgNtV7nXp
Paul Cockshott - Labor Theory of Value Playlist
https://www.youtube.com/playlist?list=PLKVcO3co5aCBnDt7k5eU8msX4DhTNUila
Paul Cockshott - Economic Planning Playlist
https://www.youtube.com/playlist?list=PLKVcO3co5aCDnkyY9YkQxpx6FxPJ23joH
Paul Cockshott - Materialism, Marxism, and Thermodynamics Playlist
https://www.youtube.com/playlist?list=PLKVcO3co5aCBv0m0fAjoOy1U4mOs_Y8QM
Victor Magariño - Austrian Economics: A Critical Analysis
https://www.youtube.com/playlist?list=PLpHi51IjLqerA1aKeGe3DcRc7zCCFkAoq
Victor Magariño - Rethinking Classical Economics
https://www.youtube.com/playlist?list=PLpHi51IjLqepj9uE1hhCrA66tMvNlnItt
Victor Magariño - Mathematics for Classical Political Economy
https://www.youtube.com/playlist?list=PLpHi51IjLqepWUHXIgVhC_Txk2WJgaSst
Geopolitical Economy Hour with Radhika Desai and Michael Hudson (someone says "he's CIA doing reheated Proudhonism" lol)
https://www.youtube.com/watch?v=X7ejfZdPboo&list=PLDAi0NdlN8hMl9DkPLikDDGccibhYHnDP
Potential Sources of Information
Leftypol Wiki Political Economy Category (needs expanding)
https://leftypedia.miraheze.org/wiki/Category:Political_economy
Sci-Hub
https://sci-hub.se/about
Marxists Internet Archive
https://www.marxists.org/
Library Genesis
https://libgen.is/
University of the Left
http://ouleft.sp-mesolite.tilted.net/Online
bannedthought.net
https://bannedthought.net/
Books scanned by Ismail from eregime.org that were uploaded to archive.org
https://archive.org/details/@ismail_badiou
The Great Soviet Encyclopedia: Articles from the GSE tend to be towards the bottom.
https://encyclopedia2.thefreedictionary.com/
EcuRed: Cuba's online encyclopedia
https://www.ecured.cu/
Books on libcom.org
https://libcom.org/book
Dictionary of Revolutionary Marxism
https://massline.org/Dictionary/index.htm
/EDU/ ebook share thread
https://leftypol.org/edu/res/22659.html
Pre-Marxist Economics (Marx studied these thinkers before writing Capital and Theories of Surplus Value)
https://www.marxists.org/reference/subject/economics/index.htm
Principle writings of Karl Marx on political economy, 1844-1883
https://www.marxists.org/archive/marx/works/subject/economy/index.htm
Speeches and Articles of Marx and Engels on Free Trade and Protectionism, 1847-1888
https://www.marxists.org/archive/marx/works/subject/free-trade/index.htm
(The Critique Of) Political Economy After Marx's Death
https://www.marxists.org/subject/economy/postmarx.htm
/Political Economy/ General #3 - Did You Forget "The Critique Of" Edition
Previous thread: >>2189753Links:
Previous Thread Archives
Thread 1 https://archive.ph/ROnpO
Thread 2 https://archive.ph/f29Po
Youtube Playlists
Anwar Shaikh - Historical Foundations of Political Economy
https://www.youtube.com/playlist?list=PLTMFx0t8kDzc72vtNWeTP05x6WYiDgEx7
Anwar Shaikh - Capitalism: Competition, Conflict and Crises
https://www.youtube.com/playlist?list=PLB1uqxcCESK6B1juh_wnKoxftZCcqA1go
Anwar Shaikh - Capitalism
https://www.youtube.com/playlist?list=PLz4k72ocf2TZMxrEVCgpp1b5K3hzFWuZh
Capital Volume 1 high quality audiobook from Andrew S. Rightenburg (Human-Read, not AI voice or TTS voice)
https://www.youtube.com/playlist?list=PLUjbFtkcDBlSHVigHHx_wjaeWmDN2W-h8
Capital Volume 2 high quality audiobook from Andrew S. Rightenburg (Human-Read, not AI voice or TTS voice)
https://www.youtube.com/playlist?list=PLUjbFtkcDBlSxnp8uR2kshvhG-5kzrjdQ
Capital Volume 3 high quality audiobook from Andrew S. Rightenburg (Human-Read, not AI voice or TTS voice)
https://www.youtube.com/playlist?list=PLUjbFtkcDBlRoV5CVoc5yyYL4nMO9ZJzO
Theories of Surplus Value high quality audiobook from Andrew S. Rightenburg (Human-Read, not AI voice or TTS voice)
https://www.youtube.com/playlist?list=PLUjbFtkcDBlQa-dFgNFtQvvMOgNtV7nXp
Paul Cockshott - Labor Theory of Value Playlist
https://www.youtube.com/playlist?list=PLKVcO3co5aCBnDt7k5eU8msX4DhTNUila
Paul Cockshott - Economic Planning Playlist
https://www.youtube.com/playlist?list=PLKVcO3co5aCDnkyY9YkQxpx6FxPJ23joH
Paul Cockshott - Materialism, Marxism, and Thermodynamics Playlist
https://www.youtube.com/playlist?list=PLKVcO3co5aCBv0m0fAjoOy1U4mOs_Y8QM
Victor Magariño - Austrian Economics: A Critical Analysis
https://www.youtube.com/playlist?list=PLpHi51IjLqerA1aKeGe3DcRc7zCCFkAoq
Victor Magariño - Rethinking Classical Economics
https://www.youtube.com/playlist?list=PLpHi51IjLqepj9uE1hhCrA66tMvNlnItt
Victor Magariño - Mathematics for Classical Political Economy
https://www.youtube.com/playlist?list=PLpHi51IjLqepWUHXIgVhC_Txk2WJgaSst
Geopolitical Economy Hour with Radhika Desai and Michael Hudson (someone says "he's CIA doing reheated Proudhonism" lol)
https://www.youtube.com/watch?v=X7ejfZdPboo&list=PLDAi0NdlN8hMl9DkPLikDDGccibhYHnDP
Potential Sources of Information
Leftypol Wiki Political Economy Category (needs expanding)
https://leftypedia.miraheze.org/wiki/Category:Political_economy
Sci-Hub
https://sci-hub.se/about
Marxists Internet Archive
https://www.marxists.org/
Library Genesis
https://libgen.is/
University of the Left
http://ouleft.sp-mesolite.tilted.net/Online
bannedthought.net
https://bannedthought.net/
Books scanned by Ismail from eregime.org that were uploaded to archive.org
https://archive.org/details/@ismail_badiou
The Great Soviet Encyclopedia: Articles from the GSE tend to be towards the bottom.
https://encyclopedia2.thefreedictionary.com/
EcuRed: Cuba's online encyclopedia
https://www.ecured.cu/
Books on libcom.org
https://libcom.org/book
Dictionary of Revolutionary Marxism
https://massline.org/Dictionary/index.htm
/EDU/ ebook share thread
https://leftypol.org/edu/res/22659.html
Pre-Marxist Economics (Marx studied these thinkers before writing Capital and Theories of Surplus Value)
https://www.marxists.org/reference/subject/economics/index.htm
Principle writings of Karl Marx on political economy, 1844-1883
https://www.marxists.org/archive/marx/works/subject/economy/index.htm
Speeches and Articles of Marx and Engels on Free Trade and Protectionism, 1847-1888
https://www.marxists.org/archive/marx/works/subject/free-trade/index.htm
(The Critique Of) Political Economy After Marx's Death
https://www.marxists.org/subject/economy/postmarx.htm
R: 7 / I: 4
Budapest Pride
Given how Orban's ban of Pride ironically turned Pride back into a symbol of resistance and increased it's attendance, have any of you Hungarian and EU comrades participated in the march?
R: 152 / I: 21
Clive Davis is arguably the most powerful man in the entertainment industry, moreso than Lucian Grainge and whomever runs Disney. He is 92 years old and an ultra-billionaire porky. Like Diddy, there have been rumors swarming for years that Davis is behind a lot of shady shit, namely running Epstein-like sex trafficking rings in the music industry since the 1970s. It is a known fact Davis was involved in one of the biggest payola scandals in the music industry in the 2000s. He is also known to commit tax fraud/evasion. Yet he hasn't been charged with anything. This can be explained by the suspicions Davis is a federal informant who's been working with the FBI for decades to get blackmail dirt on celebrities, identical to Epstein and Ghislaine Maxwell.
Davis essentially buckbroke Diddy when Diddy first entered the music industry. Everything Diddy is currently charged with are things he learned from Davis. It gets deeper when you look at the trial. Diddy, like his mentor Davis, is also an alleged FBI informant. It's rumored Diddy orchestrated Tupac's murder (the feds wanted Pac dead because he was a Black communist breadpilling people through his rhymes) and almost certainly had something to do with Biggie's death as well. The prosecutor against Diddy is allegedly James Comey's daughter, Comney being the same prosecutor in the Epstein/Maxwell case. Given that the prosecution is currently floundering (they have yet to prove Diddy is a sex trafficker, only that he's a sexual pervert with a piss and cuckold fetish) one can easily see that this is allegedly a cover up of an alleged cover up: either Diddy walks free and everyone involved goes about doing their evil, or Diddy is found guilty and becomes the fall guy while the bigger villains (specifically Davis) go unchecked.
To put the cherry on the sundae: Clive Davis owns a school at NYU, the Clive Davis Institute of Recorded Music. Everyone who teaches there is getting paid by Clive; you can clearly see an overlap with the Congress for Cultural Freedom.
The biggest capitalist villain
Given everything that's come out during the Diddy trial, I find it highly suspicious that Clive Davis hasn't been mentioned once.Clive Davis is arguably the most powerful man in the entertainment industry, moreso than Lucian Grainge and whomever runs Disney. He is 92 years old and an ultra-billionaire porky. Like Diddy, there have been rumors swarming for years that Davis is behind a lot of shady shit, namely running Epstein-like sex trafficking rings in the music industry since the 1970s. It is a known fact Davis was involved in one of the biggest payola scandals in the music industry in the 2000s. He is also known to commit tax fraud/evasion. Yet he hasn't been charged with anything. This can be explained by the suspicions Davis is a federal informant who's been working with the FBI for decades to get blackmail dirt on celebrities, identical to Epstein and Ghislaine Maxwell.
Davis essentially buckbroke Diddy when Diddy first entered the music industry. Everything Diddy is currently charged with are things he learned from Davis. It gets deeper when you look at the trial. Diddy, like his mentor Davis, is also an alleged FBI informant. It's rumored Diddy orchestrated Tupac's murder (the feds wanted Pac dead because he was a Black communist breadpilling people through his rhymes) and almost certainly had something to do with Biggie's death as well. The prosecutor against Diddy is allegedly James Comey's daughter, Comney being the same prosecutor in the Epstein/Maxwell case. Given that the prosecution is currently floundering (they have yet to prove Diddy is a sex trafficker, only that he's a sexual pervert with a piss and cuckold fetish) one can easily see that this is allegedly a cover up of an alleged cover up: either Diddy walks free and everyone involved goes about doing their evil, or Diddy is found guilty and becomes the fall guy while the bigger villains (specifically Davis) go unchecked.
To put the cherry on the sundae: Clive Davis owns a school at NYU, the Clive Davis Institute of Recorded Music. Everyone who teaches there is getting paid by Clive; you can clearly see an overlap with the Congress for Cultural Freedom.
R: 12 / I: 3
We need to talk about the namefag "glowing rapefiend" for a second. Why is a nonce allowed to be on this site? All he does is post grotesque degenerate porn everywhere.
We need to talk about the namefag "glowing rapefiend" for a second. Why is a nonce allowed to be on this site? All he does is post grotesque degenerate porn everywhere.
R: 489 / I: 228
Tomoko thread… why? Because I like the character… and other reasons…
Post lewds (spoilered), memes, edits, pics and anything else related to the subject
Tomoko thread… why? Because I like the character… and other reasons…
Post lewds (spoilered), memes, edits, pics and anything else related to the subject
R: 48 / I: 17
Digital Grass Checkpoint
Link to at least one website you didn't know about prior to today. If you don't have one, open up a new tab and explore until you find one.
R: 328 / I: 95
Original threads:
https://archive.ph/S2XYA
https://archive.ph/Ytckv
leftypol.org archives:
https://archive.is/https://leftypol.org/leftypol/res/30501.html
bunekrchan.xyz archives:
https://archive.is/https://bunkerchan.xyz/leftypol/res/8925.html
https://archive.is/yrBUN
https://archive.is/pCecr
previous thread: >>2287001
/PRC/ People's Republic of China 11
>Hacking the Gibson…Original threads:
https://archive.ph/S2XYA
https://archive.ph/Ytckv
leftypol.org archives:
https://archive.is/https://leftypol.org/leftypol/res/30501.html
bunekrchan.xyz archives:
https://archive.is/https://bunkerchan.xyz/leftypol/res/8925.html
https://archive.is/yrBUN
https://archive.is/pCecr
previous thread: >>2287001
R: 120 / I: 23
What the fuck was up with communist parties back then associating being gay with the petit-bourgeoisie? What exactly about fucking a dude is petit-bourgeois?
What the fuck was up with communist parties back then associating being gay with the petit-bourgeoisie? What exactly about fucking a dude is petit-bourgeois?
R: 30 / I: 4
Post your favorite Folk-Punk
I'll start
Post your favorite Folk-Punk
I'll start
R: 197 / I: 3
Hip Hop General
Hip hop of any genre
R: 19 / I: 9
Check this one out: a "weed bomb". You create a device which using some kind of extreme direct heat (but contained, possibly in a metal sphere like a grenade, but with vent holes) which combusts like a quarter ounce of hash concentrate in under a minute.
It'd be a party trick/prank or something. You'd set the timer, roll it into the room on the floor like a skee ball, and shut the door. The thing would blink lights and beepboop maybe and then just start spraying pure THC smoke into the air, perhaps rolling around on its own power like a firework or something, or a fucking Batman gadget! Yeah. It'd be an instant hotbox. You could do it in a car too, though it might be too much. Hey, different sizes maybe.
Well, it'll probably never happen because it'd be considered "assault" or "poisoning without consent" or something, so I'm giving my million dollar idea away, but it's a fun fantasy.
What do you think? Would that be a neat product?
Drug Inspirations/Million Dollar Ideas
I love getting stoned because it gives me awesome ideas.Check this one out: a "weed bomb". You create a device which using some kind of extreme direct heat (but contained, possibly in a metal sphere like a grenade, but with vent holes) which combusts like a quarter ounce of hash concentrate in under a minute.
It'd be a party trick/prank or something. You'd set the timer, roll it into the room on the floor like a skee ball, and shut the door. The thing would blink lights and beepboop maybe and then just start spraying pure THC smoke into the air, perhaps rolling around on its own power like a firework or something, or a fucking Batman gadget! Yeah. It'd be an instant hotbox. You could do it in a car too, though it might be too much. Hey, different sizes maybe.
Well, it'll probably never happen because it'd be considered "assault" or "poisoning without consent" or something, so I'm giving my million dollar idea away, but it's a fun fantasy.
What do you think? Would that be a neat product?
R: 9 / I: 3
I recently got arrested in Mexico City and had a few books on Stalin and Lenin with me.
The Mexican cop took out my books, and raised his eyebrows.
“Te gusta Stalin?” He asked.
“Si.” I said.
A huge grin came over his face.
“Yo tambien” He said.
I recently got arrested in Mexico City and had a few books on Stalin and Lenin with me.
The Mexican cop took out my books, and raised his eyebrows.
“Te gusta Stalin?” He asked.
“Si.” I said.
A huge grin came over his face.
“Yo tambien” He said.
R: 19 / I: 3
Under communism everyone is going to drive a Truck, personal preferences would yield to collective efficiency, and citizens might be required to drive full-size trucks—not out of luxury, but necessity. These trucks, thanks to their versatile design, can serve multiple roles: transporting goods, commuting, and performing labor tasks, all in one vehicle. Producing just one standardized model would allow for massive economies of scale, reducing waste and simplifying maintenance infrastructure. While some individuals may resent the bulk or fuel consumption of such a vehicle, the broader societal benefit—streamlined production, resource conservation, and universal utility—would take precedence. In this vision, the discomfort of a few is outweighed by the collective gain, as uniformity ensures everyone has access to reliable, multi-purpose transportation suited for the needs of the state and the people.
Under communism everyone is going to drive a Truck, personal preferences would yield to collective efficiency, and citizens might be required to drive full-size trucks—not out of luxury, but necessity. These trucks, thanks to their versatile design, can serve multiple roles: transporting goods, commuting, and performing labor tasks, all in one vehicle. Producing just one standardized model would allow for massive economies of scale, reducing waste and simplifying maintenance infrastructure. While some individuals may resent the bulk or fuel consumption of such a vehicle, the broader societal benefit—streamlined production, resource conservation, and universal utility—would take precedence. In this vision, the discomfort of a few is outweighed by the collective gain, as uniformity ensures everyone has access to reliable, multi-purpose transportation suited for the needs of the state and the people.
R: 34 / I: 11
I personally think the most important decisive factor is the image, he needs to make the party symbol a cowboy hat next to an Indian chief war bonnet. Considering how many people drool over symbolism.
Elon Musk's Party
Will he be the one to break the Demopublican party's grasp on bourgeois elections and continue a new reign of the dictatorship of the bourgeoisie or will he crumble as he pours his money into a failed campaign? Will he split the Right wing of capital? Was it dumb that he didn't just pour finances into the lolbert party instead?I personally think the most important decisive factor is the image, he needs to make the party symbol a cowboy hat next to an Indian chief war bonnet. Considering how many people drool over symbolism.
R: 2 / I: 0
For those unaware, the manga is about a demon lord who wants to end the enslavement of non-human races, but fails, gets killed and regresses through time.
The Reincarnated King of Fists
What's the board consensus on the manhua "The Reincarnated King of Fists"?For those unaware, the manga is about a demon lord who wants to end the enslavement of non-human races, but fails, gets killed and regresses through time.
R: 11 / I: 2
That said, both capitalism and socialism are just ways to allocate resources and distribute rewards for producing them. There's a billion things to be said about socialism resorce wise, but what critiques do we have against capitalism?
Are we making too much of useless things while we could've been making something else? e.g sex work
Are we NOT making something we should and can make? e.g housing
Are we wasting something when we could've distributed it? e.g foreign aid
Pose the most egregious examples ITT.
Let's criticize resource distribution in capitalist economies
One of the most common downsides of leftist economic policy is wasteful spending. Indeed, bureaucracy isn't perfect, gets bloated easily, and goverment employees with no incenitive to do better would fare WORSE than an employee of a private company in the same situation.That said, both capitalism and socialism are just ways to allocate resources and distribute rewards for producing them. There's a billion things to be said about socialism resorce wise, but what critiques do we have against capitalism?
Are we making too much of useless things while we could've been making something else? e.g sex work
Are we NOT making something we should and can make? e.g housing
Are we wasting something when we could've distributed it? e.g foreign aid
Pose the most egregious examples ITT.
R: 42 / I: 8
>hurrr im gonna draw shit men do except with a woman doing it instead
why are gooners so retarded
this sould definitely be enough characters on its own but whatever
>hurrr im gonna draw shit men do except with a woman doing it instead
why are gooners so retarded
this sould definitely be enough characters on its own but whatever
R: 13 / I: 1
What do you do when you have no personality? No one cares about whatever interests and hobbies I get into or what I do. They will always see a bore at the core. You can only spend so much time pretending with another personality until they notice the cracks.
What do you do when you have no personality? No one cares about whatever interests and hobbies I get into or what I do. They will always see a bore at the core. You can only spend so much time pretending with another personality until they notice the cracks.
R: 3 / I: 0
Is there any difference between Juche and autarky? i mean, both argue the need for self reliance don't they?
explain in ten billion words or however many leftypol wants nowadays
Is there any difference between Juche and autarky? i mean, both argue the need for self reliance don't they?
explain in ten billion words or however many leftypol wants nowadays
R: 12 / I: 1
Contribute whatever you can please
It can be about any race
yes I know Im a weirdo. Race taboo makes me ROCK HARD
the title says it all
Contribute whatever you can please
the title says it all
Contribute whatever you can please
RACEPLAY PORN
the title says it allContribute whatever you can please
It can be about any race
yes I know Im a weirdo. Race taboo makes me ROCK HARD
the title says it all
Contribute whatever you can please
the title says it all
Contribute whatever you can please
R: 30 / I: 13
we used to goon to ts 💔
we used to goon to ts 💔
R: 169 / I: 50
Archived threads:
https://archive.is/xiA7y
nu-imageboard megathread #2
The neverending quest to rewrite vichan -Archived threads:
https://archive.is/xiA7y
R: 506 / I: 173
>>2293957
————————
🚨 Live Happenings/Updates 🚨
Sites that have active live-blogs:
• Al-Jazeera: https://www.aljazeera.com/
• Middle East Eye: https://www.middleeasteye.net/israel-palestine-hamas-war-gaza-live-invasion
• The Guardian: https://www.theguardian.com/world/palestinian-territories
• Times of Israel: https://www.timesofisrael.com/topic/liveblog/ (trigger warning)
—————————————————–————————
WIKI
Our own wiki. Be sure to add to it and create branching articles:
https://wiki.leftypol.org/wiki/2023_Israel–Gaza_war [Currently Down]
—————————————————–————————
🗣️ RECOMMENDED SITES ✍️
• https://electronicintifada.net
From the UK, single issue long time Palestinian investigative and general reporting, critical source
• https://mondoweiss.net/
From the USA
• https://new.thecradle.co/
Regional news from an anti-imperialist perspective
• https://www.btselem.org/Isrsaeli
Premier Human Rights org
• https://www.972mag.com/
Left news and opinion webzine from Tel-Aviv
• https://decolonizepalestine.com/
A collection of resources for organizers and anyone who wants to learn more about Palestine
• https://www.normanfinkelstein.com/blogs/
Known anti-zionist academic Norman Finkelstein's blog
—————————————————————————
💣🔫RESISTANCE💣🔫
al-Qassam Brigades
https://en.alqassam.ps/
PFLP
http://pflp.ps/
—————————————————–————————
📺 WATCH TOGETHER 📺
https://tv.leftypol.org/r/LGBTA
—————————————————–————————
✊🪧 TAKE ACTION AND TOUCH GRASS 🏴🔥
(USA)
• https://www.answercoalition.org/join_a_protest_near_you_free_palestine
(UK+USA)
• https://www.palestineaction.org/
—————————————————–————————
HIDE JIDF POSTS, IGNORE GLOWIE BAIT, DO NOT REPLY TO MOSSAD POSTERS
(This includes blatantly obvious concern failtrolling/fedposting, painfully unfunny/nuclear misanthropic autism [ie. /pol/] and derailing/hyper sectarian schizophrenia, excessive doomer and jewish-blood-quantum posting)
Always remember to double-check your sources, as well as provide access to it.
الله أكبر
.الى جميع الكادحين في الشرق، ان مصيركم في ايديكم
Fdpd. trash site 123 blah fd
palestine vs the zionist entity-119 Flotilla of Hate Edition
🇵🇸 PREVIOUSLY ON THE HOLY LAND 🇵🇸————————
🚨 Live Happenings/Updates 🚨
Sites that have active live-blogs:
• Al-Jazeera: https://www.aljazeera.com/
• Middle East Eye: https://www.middleeasteye.net/israel-palestine-hamas-war-gaza-live-invasion
• The Guardian: https://www.theguardian.com/world/palestinian-territories
• Times of Israel: https://www.timesofisrael.com/topic/liveblog/ (trigger warning)
—————————————————–————————
WIKI
Our own wiki. Be sure to add to it and create branching articles:
https://wiki.leftypol.org/wiki/2023_Israel–Gaza_war [Currently Down]
—————————————————–————————
🗣️ RECOMMENDED SITES ✍️
• https://electronicintifada.net
From the UK, single issue long time Palestinian investigative and general reporting, critical source
• https://mondoweiss.net/
From the USA
• https://new.thecradle.co/
Regional news from an anti-imperialist perspective
• https://www.btselem.org/Isrsaeli
Premier Human Rights org
• https://www.972mag.com/
Left news and opinion webzine from Tel-Aviv
• https://decolonizepalestine.com/
A collection of resources for organizers and anyone who wants to learn more about Palestine
• https://www.normanfinkelstein.com/blogs/
Known anti-zionist academic Norman Finkelstein's blog
—————————————————————————
💣🔫RESISTANCE💣🔫
al-Qassam Brigades
https://en.alqassam.ps/
PFLP
http://pflp.ps/
—————————————————–————————
📺 WATCH TOGETHER 📺
https://tv.leftypol.org/r/LGBTA
—————————————————–————————
✊🪧 TAKE ACTION AND TOUCH GRASS 🏴🔥
(USA)
• https://www.answercoalition.org/join_a_protest_near_you_free_palestine
(UK+USA)
• https://www.palestineaction.org/
—————————————————–————————
HIDE JIDF POSTS, IGNORE GLOWIE BAIT, DO NOT REPLY TO MOSSAD POSTERS
(This includes blatantly obvious concern failtrolling/fedposting, painfully unfunny/nuclear misanthropic autism [ie. /pol/] and derailing/hyper sectarian schizophrenia, excessive doomer and jewish-blood-quantum posting)
Always remember to double-check your sources, as well as provide access to it.
الله أكبر
.الى جميع الكادحين في الشرق، ان مصيركم في ايديكم
Fdpd. trash site 123 blah fd
R: 257 / I: 400
<Avatard RP reactionary leech is oUr fWiEnD u GuIsE
Royal Colony 13
by invitation of bronies & Tania<Avatard RP reactionary leech is oUr fWiEnD u GuIsE
R: 409 / I: 152
Made a new thread since the other one is full. You know the drill folks, gather here to discuss and/or complain about Hearts of Iron 4 and all the alt history mods that make the game relevant. From green natpops to sicko mode Savinkov we've got a lot of exciting stuff coming in the next Kaiserreich update, one which will make the LKMT look like pre-rework Germany by comparison. But dont worry TNOomers, you're getting some new content too! After a year and a half and three focus trees that only last for four years, we finally have something new and that's…
…three years of fucking Antarctica
HoI4 + HoI4 modding thread
Operation Deep Sneed editionMade a new thread since the other one is full. You know the drill folks, gather here to discuss and/or complain about Hearts of Iron 4 and all the alt history mods that make the game relevant. From green natpops to sicko mode Savinkov we've got a lot of exciting stuff coming in the next Kaiserreich update, one which will make the LKMT look like pre-rework Germany by comparison. But dont worry TNOomers, you're getting some new content too! After a year and a half and three focus trees that only last for four years, we finally have something new and that's…
…three years of fucking Antarctica
R: 17 / I: 0
There are a variety of theories of the origin of capital, but they fail to reach any meaningful conclusions, and that is because they do not take into account this fact which we know to be true. I want to make a proper investigation into the origin of capital with the premise that it is not a socioeconomic phenomenon, that it was not created by humans, and that we should be able to locate a physical trace of capital which precedes human contact.
This line of questioning encompasses many possible origins of capital which each take us down a new road, and I'd like to start probing them ITT.
For example: capital as a zoonotic virus. Does the arrival of capital in the human world coincide with human disturbance of a particular ecosystem, increased prevalence of husbandry of a particular animal, an unusual climate or weather pattern which might have resulted in sustained human interaction with a population of birds or insects etc.
Capitalism also correlates with genetic and epigenetic changes in humans. EG, when capital is introduced to humans, hypermethylation of the glucocorticoid receptor gene (NR3C1) occurs. It is possible that a change in the environment caused a human population to undergo an acute genetic change, and that Capitalism first arose from this epigenetic event.
These are the sort of things we should be looking for physical evidence of, something hidden in tree rings, sediment layers, deep ocean currents, microscopic images of meteor fragments; this study has erroneously been delegated to anthropologists, economists, sociologists, and I encourage professionals of any and all disciplines to pursue novel theories of the origin of capital, not bound by the premise of a human origin which common sense tells us is false.
Investigation of Archeo-Capital
Intuitively, we know that capital did not originate in humans.There are a variety of theories of the origin of capital, but they fail to reach any meaningful conclusions, and that is because they do not take into account this fact which we know to be true. I want to make a proper investigation into the origin of capital with the premise that it is not a socioeconomic phenomenon, that it was not created by humans, and that we should be able to locate a physical trace of capital which precedes human contact.
This line of questioning encompasses many possible origins of capital which each take us down a new road, and I'd like to start probing them ITT.
For example: capital as a zoonotic virus. Does the arrival of capital in the human world coincide with human disturbance of a particular ecosystem, increased prevalence of husbandry of a particular animal, an unusual climate or weather pattern which might have resulted in sustained human interaction with a population of birds or insects etc.
Capitalism also correlates with genetic and epigenetic changes in humans. EG, when capital is introduced to humans, hypermethylation of the glucocorticoid receptor gene (NR3C1) occurs. It is possible that a change in the environment caused a human population to undergo an acute genetic change, and that Capitalism first arose from this epigenetic event.
These are the sort of things we should be looking for physical evidence of, something hidden in tree rings, sediment layers, deep ocean currents, microscopic images of meteor fragments; this study has erroneously been delegated to anthropologists, economists, sociologists, and I encourage professionals of any and all disciplines to pursue novel theories of the origin of capital, not bound by the premise of a human origin which common sense tells us is false.
R: 16 / I: 0
Anti-USApol
This is a thread dedicated to anti-Americanism. No great deep theory is needed. As long as you have burning hatred for America and Americans, you are welcome to post here. We can also keep the thread as a place to compile all the crimes of Amerikkka and the cringe of Amerikkkans, past, present, and future.
R: 10 / I: 7
https://lefty.pictures/post/view/25424?search=Alex_jones
https://apnews.com/article/elon-musk-political-party-92353942308fee929a937b17113e077e
Isnt'real to forcibly draft ultra-Orthodox seminary students
The military orders follow a court decision ending exemptions for the community, thus Isn'treal military has announced plans to forcibly draft 54,000 ultra-Orthodox seminary students this month following a Supreme Court order nullifying their exemptions, the IDF reported in a Telegram post on Sunday.
https://www.rt.com/news/621197-israel-ultra-orthodox-draft/
Israel plans to move Gaza population to single ‘humanitarian city’ – defense minister
The Palestinians will not be allowed to leave the camp except for “voluntarily” emigrating to other countries, Israel Katz says.
https://www.rt.com/news/621192-israel-gaza-displacement-plan/
European Parliament approves Bulgaria's adoption of the euro
The vote came as thousands of Bulgarians have protested in recent weeks against joining the eurozone. The EU Reich WILL BE DEFEATED, ЗОВ ЗОВ ЗОВ ЗОВ! ЗА РОZZИЯ! ДАВАЙ! ВПЕРЕД! ДАВАЙ CUCKTIN! НАМ НУЖНО ОСВОБОДИТЬ НАШИХ БОЛГАРСКИХ СЛАВЯНСКИХ БРАТЬЕВ! Z O V ! Z O V ! ZА ЕВРАЗИЯ!
https://www.euronews.com/2025/07/08/european-parliament-approves-bulgarias-adoption-of-the-euro
Ukrainian teachers told to pretend they can’t speak Russian
UKORP NAZI STATE BRAINWASHING ITS PEOPLE, FALSIFYING HISTORY, UA IS RUZZIAAAAAAAAAAAAA
The country’s education ombudsman has urged teachers to use only Ukrainian with students.
https://www.rt.com/russia/621176-ukraine-teachers-russian-language/
RuZZians Storm Novoekonomicheskoe in Pivotal Push To Mirnograd-Pokrovsk Agglomeration
RuZZian troops have launched a decisive assault on the strategically vital town of Novoekonomicheskoe west of Mirnograd on the Pokrovsk front. After weeks of incremental advances, mechanized units from RuZZia’s Center group of forces breached Ukorp defenses, pushing into the settlement amid fierce resistance. Ukorp banderite forces, battered by drone strikes and artillery, now risk encirclement as RuZZian troops tighten the noose from multiple directions.
https://southfront.press/russians-storm-novoekonomicheskoe-in-pivotal-push-to-mirnograd-pokrovsk-agglomeration/
Second Ship Attacked Near Yemen Within Days, Sailors Killed
Two sailors of the Liberian-flagged, Greek-owned bulk carrier ship Eternity C were killed late on July 7 when the vessel came under attack in the Red Sea off the coast of Yemen, Liberia’s delegation told a meeting of the United Nations’ International Maritime Organization the following day.
https://southfront.press/second-ship-attacked-near-yemen-within-days-sailors-killed/
BREAKING: Russian Flags Waving In Kamenskoe After Week-Long Assault
According to preliminary reports from the front, Russian troops have secured a decisive victory in the battle for Kamenskoe, with soldiers from the 247th Rostov Battalion raising the Russian flag in the center of the settlement, marking its full liberation from Ukrainian forces. After a week of intense combat, the town has fallen under Russian control, dealing a significant blow to Ukrainian defense on the Zaporozhzhie front.
https://southfront.press/breaking-russian-flags-waving-in-kamenskoe-after-week-long-assault/
Desertion Crisis in Ukorp Army Reaches Alarming Levels
The Armed Forces of Ukraine continue to face a severe desertion problem, with newly released data showing that 17,082 soldiers fled their units in June 2025 alone. While this figure represents a slight decrease from May’s 19,956 desertions, the overall trend remains devastating for Kyiv’s war effort. Since the beginning of the year, a staggering 107,672 Ukrainian servicemen have abandoned their posts, with only 1,807 (1.7%) being successfully returned to duty.
https://southfront.press/desertion-crisis-in-ukrainian-army-reaches-alarming-levels/
Another Bad Day For Isnt'real Army In Gaza, 19 Troops Killed Or Wounded In Daring Attack
Five Settler soldiers were killed and 14 were wounded after coming under attack in the area of Beit Hanoun in the northern Gaza Strip late on July 7, the Isn'treal Defense Forces (IDF) announced.
https://southfront.press/another-bad-day-for-israeli-army-in-gaza-19-troops-killed-or-wounded-in-daring-attack/
Chinese premier calls for commitment to building open world economy
Chinese Premier Li Qiang has called for commitment to building an open world economy, and stressed the importance of opposing unilateralism and protectionism.
https://news.cgtn.com/news/2025-07-08/Chinese-premier-calls-for-commitment-to-building-open-world-economy-1EPJiKRfw5O/p.html
Delaware to Begin Recreational Cannabis Sales on August 1
Delaware will launch recreational cannabis sales on August 1. Thirteen medical dispensaries will serve adult-use customers first, while new licensees face delays due to zoning and funding barriers.
https://hightimes.com/news/delaware-to-begin-recreational-cannabis-sales-on-august-1/
Bull wrangled five days after Colorado rodeo escape
A bull that escaped while being unloaded at a Colorado rodeo was finally wrangled after five days on the loose.
https://www.upi.com/Odd_News/2025/07/08/escaped-rodeo-bull-captured-Snowmass-Colorado/6261751988247/
Family of Infamous Lebanese Torturer Wins $8 Million in US Court
The family of infamous Lebanese torturer Amer Fakhoury has just won $8 million in U.S. court after suing Iran for his death while in detention. Rania Khalek tells Eugene Puryear this story reveals the epitome of U.S. imperial hypocrisy.
https://breakthroughnews.org/family-of-infamous-lebanese-torturer-wins-8-million-in-us-court/
News 08/07/25
Musk creates a new party, exactly like the party from the movie The Purge probably, ALEX JONES PREDICTED IThttps://lefty.pictures/post/view/25424?search=Alex_jones
https://apnews.com/article/elon-musk-political-party-92353942308fee929a937b17113e077e
Isnt'real to forcibly draft ultra-Orthodox seminary students
The military orders follow a court decision ending exemptions for the community, thus Isn'treal military has announced plans to forcibly draft 54,000 ultra-Orthodox seminary students this month following a Supreme Court order nullifying their exemptions, the IDF reported in a Telegram post on Sunday.
https://www.rt.com/news/621197-israel-ultra-orthodox-draft/
Israel plans to move Gaza population to single ‘humanitarian city’ – defense minister
The Palestinians will not be allowed to leave the camp except for “voluntarily” emigrating to other countries, Israel Katz says.
https://www.rt.com/news/621192-israel-gaza-displacement-plan/
European Parliament approves Bulgaria's adoption of the euro
The vote came as thousands of Bulgarians have protested in recent weeks against joining the eurozone. The EU Reich WILL BE DEFEATED, ЗОВ ЗОВ ЗОВ ЗОВ! ЗА РОZZИЯ! ДАВАЙ! ВПЕРЕД! ДАВАЙ CUCKTIN! НАМ НУЖНО ОСВОБОДИТЬ НАШИХ БОЛГАРСКИХ СЛАВЯНСКИХ БРАТЬЕВ! Z O V ! Z O V ! ZА ЕВРАЗИЯ!
https://www.euronews.com/2025/07/08/european-parliament-approves-bulgarias-adoption-of-the-euro
Ukrainian teachers told to pretend they can’t speak Russian
UKORP NAZI STATE BRAINWASHING ITS PEOPLE, FALSIFYING HISTORY, UA IS RUZZIAAAAAAAAAAAAA
The country’s education ombudsman has urged teachers to use only Ukrainian with students.
https://www.rt.com/russia/621176-ukraine-teachers-russian-language/
RuZZians Storm Novoekonomicheskoe in Pivotal Push To Mirnograd-Pokrovsk Agglomeration
RuZZian troops have launched a decisive assault on the strategically vital town of Novoekonomicheskoe west of Mirnograd on the Pokrovsk front. After weeks of incremental advances, mechanized units from RuZZia’s Center group of forces breached Ukorp defenses, pushing into the settlement amid fierce resistance. Ukorp banderite forces, battered by drone strikes and artillery, now risk encirclement as RuZZian troops tighten the noose from multiple directions.
https://southfront.press/russians-storm-novoekonomicheskoe-in-pivotal-push-to-mirnograd-pokrovsk-agglomeration/
Second Ship Attacked Near Yemen Within Days, Sailors Killed
Two sailors of the Liberian-flagged, Greek-owned bulk carrier ship Eternity C were killed late on July 7 when the vessel came under attack in the Red Sea off the coast of Yemen, Liberia’s delegation told a meeting of the United Nations’ International Maritime Organization the following day.
https://southfront.press/second-ship-attacked-near-yemen-within-days-sailors-killed/
BREAKING: Russian Flags Waving In Kamenskoe After Week-Long Assault
According to preliminary reports from the front, Russian troops have secured a decisive victory in the battle for Kamenskoe, with soldiers from the 247th Rostov Battalion raising the Russian flag in the center of the settlement, marking its full liberation from Ukrainian forces. After a week of intense combat, the town has fallen under Russian control, dealing a significant blow to Ukrainian defense on the Zaporozhzhie front.
https://southfront.press/breaking-russian-flags-waving-in-kamenskoe-after-week-long-assault/
Desertion Crisis in Ukorp Army Reaches Alarming Levels
The Armed Forces of Ukraine continue to face a severe desertion problem, with newly released data showing that 17,082 soldiers fled their units in June 2025 alone. While this figure represents a slight decrease from May’s 19,956 desertions, the overall trend remains devastating for Kyiv’s war effort. Since the beginning of the year, a staggering 107,672 Ukrainian servicemen have abandoned their posts, with only 1,807 (1.7%) being successfully returned to duty.
https://southfront.press/desertion-crisis-in-ukrainian-army-reaches-alarming-levels/
Another Bad Day For Isnt'real Army In Gaza, 19 Troops Killed Or Wounded In Daring Attack
Five Settler soldiers were killed and 14 were wounded after coming under attack in the area of Beit Hanoun in the northern Gaza Strip late on July 7, the Isn'treal Defense Forces (IDF) announced.
https://southfront.press/another-bad-day-for-israeli-army-in-gaza-19-troops-killed-or-wounded-in-daring-attack/
Chinese premier calls for commitment to building open world economy
Chinese Premier Li Qiang has called for commitment to building an open world economy, and stressed the importance of opposing unilateralism and protectionism.
https://news.cgtn.com/news/2025-07-08/Chinese-premier-calls-for-commitment-to-building-open-world-economy-1EPJiKRfw5O/p.html
Delaware to Begin Recreational Cannabis Sales on August 1
Delaware will launch recreational cannabis sales on August 1. Thirteen medical dispensaries will serve adult-use customers first, while new licensees face delays due to zoning and funding barriers.
https://hightimes.com/news/delaware-to-begin-recreational-cannabis-sales-on-august-1/
Bull wrangled five days after Colorado rodeo escape
A bull that escaped while being unloaded at a Colorado rodeo was finally wrangled after five days on the loose.
https://www.upi.com/Odd_News/2025/07/08/escaped-rodeo-bull-captured-Snowmass-Colorado/6261751988247/
Family of Infamous Lebanese Torturer Wins $8 Million in US Court
The family of infamous Lebanese torturer Amer Fakhoury has just won $8 million in U.S. court after suing Iran for his death while in detention. Rania Khalek tells Eugene Puryear this story reveals the epitome of U.S. imperial hypocrisy.
https://breakthroughnews.org/family-of-infamous-lebanese-torturer-wins-8-million-in-us-court/
R: 2 / I: 0
Confession
Guys, i’ve gotta come clean about something: i don’t actually read anything thats written on this site, i only come here to look at the funny pictures
R: 293 / I: 57
<Abolish Religion.
<Abolish Wage Labour.
<Abolish Money.
<Abolish Work.
<Abolish Commodity Production.
<Abolish the State.
<Abolish Class.
<Abolish Private Property.
<Abolish the Nation.
<Abolish Patriarchy.
<Abolish Gender.
<Abolish Town and Country.
If you don't think these are the ultimate goals for a communist party or organization to achieve, I'm sorry to say this but you're not a communist but rather just an edgy social democrat.
If you disagree with any of these, you're not a communist
<Abolish The Family.<Abolish Religion.
<Abolish Wage Labour.
<Abolish Money.
<Abolish Work.
<Abolish Commodity Production.
<Abolish the State.
<Abolish Class.
<Abolish Private Property.
<Abolish the Nation.
<Abolish Patriarchy.
<Abolish Gender.
<Abolish Town and Country.
If you don't think these are the ultimate goals for a communist party or organization to achieve, I'm sorry to say this but you're not a communist but rather just an edgy social democrat.
R: 25 / I: 3
new to leftist spheres
i have never communicated in any leftist spheres before on the internet and am not particularly a leftist. what are some leftist redpills? how does one come to understand leftist thought? good reading or viewing material would be nice and do not feel obliged to dumb things down.
R: 613 / I: 168 (full)
<Shitting BRICS edition
Thread for the hellish discussion related to the scourge of the earth, the destroyer of nations, the king of coups, the sultan of sanctions, the emir of the embargo, the autocrat of austerity, the doge of deregulation, the baron of busting unions, the prince of privatization, the lord of loan sharks, the patron-saint of proxy wars, the sponsor of settlers, the guarantor of genocides, the Divided $nakkkes of Amerikkka™
🏈 💵 🌭 🍔
🛠️ Strike Tracker ⚒️
https://striketracker.ilr.cornell.edu/
🇺🇸 Deeds of the Burger Reich 🇺🇸
https://github.com/dessalines/essays/blob/main/us_atrocities.md
📺 Live News 📺
(sponsored by USAID)
• CNN: https://www.livenewsnow.com/american/cnn-news-usa.html
• MSNBC: https://www.livenewsnow.com/american/msnbc.html
• FOX: https://www.livenewsnow.com/american/fox-news-channel.html
• Bloomberg: https://www.bloomberg.com/live/us
✊ Live Protest Streams ✊
https://woke.net/
Epstein's Client List DOES NOT EXIST
https://epsteinsblackbook.com/
Previous Thread: >>2377038
/USApol/ 🇺🇸
🗽UNITED STATES POLITICS 🦅<Shitting BRICS edition
Thread for the hellish discussion related to the scourge of the earth, the destroyer of nations, the king of coups, the sultan of sanctions, the emir of the embargo, the autocrat of austerity, the doge of deregulation, the baron of busting unions, the prince of privatization, the lord of loan sharks, the patron-saint of proxy wars, the sponsor of settlers, the guarantor of genocides, the Divided $nakkkes of Amerikkka™
🏈 💵 🌭 🍔
🛠️ Strike Tracker ⚒️
https://striketracker.ilr.cornell.edu/
🇺🇸 Deeds of the Burger Reich 🇺🇸
https://github.com/dessalines/essays/blob/main/us_atrocities.md
📺 Live News 📺
(sponsored by USAID)
• CNN: https://www.livenewsnow.com/american/cnn-news-usa.html
• MSNBC: https://www.livenewsnow.com/american/msnbc.html
• FOX: https://www.livenewsnow.com/american/fox-news-channel.html
• Bloomberg: https://www.bloomberg.com/live/us
✊ Live Protest Streams ✊
https://woke.net/
Epstein's Client List DOES NOT EXIST
https://epsteinsblackbook.com/
Previous Thread: >>2377038
R: 27 / I: 11
>Stopped counter-revolution cold in Czechoslovakia
>Aided Vietnam in its war against American imperialism
>Still lives rent-free in the heads of Maoists, pro-Hoxha "Anti-Revisionists" and pro-NATO liberals despite being dead for 43 years
Discuss one of the most under-rated socialists.
/brezhnev/ General
>Undid Cornman's retardation>Stopped counter-revolution cold in Czechoslovakia
>Aided Vietnam in its war against American imperialism
>Still lives rent-free in the heads of Maoists, pro-Hoxha "Anti-Revisionists" and pro-NATO liberals despite being dead for 43 years
Discuss one of the most under-rated socialists.
R: 6 / I: 3
These developments concern me because the Western left won't quit. We won't admit ideological defeat, learn from China's facts, and progress towards a post-neoliberalism that is not fascist. Instead, we continue to indulge "non-hierarchical" fantasies that have failed completely. I think China has reeducated us and has taught us their approach is the most correct approach to post-capitalism. There isn't actually another correct way to do socialism, and the more time we waste the closer we come to American fascism and ecological collapse.
25 years of 21st century leftism
It's 2025. We are now closer to 2050 than 2000. What has the left achieved this century? As far as I can tell the Western left has achieved nothing. Neoliberalism continues to get worse. It has successfully created a fake opposition on the right. You can call it populism, nativism, racism, MAGA et cetera, but it is really just a controlled opposition that does whatever capitalists want. In the East we see China. China has become the world's largest car manufacturer in the last five years. This change happened post-COVID and with heavy tariffs from the West. China has also lifted hundreds of millions of people out of poverty within its own borders and it has become the number one trading partner of most of the word's nations, including most American nations.These developments concern me because the Western left won't quit. We won't admit ideological defeat, learn from China's facts, and progress towards a post-neoliberalism that is not fascist. Instead, we continue to indulge "non-hierarchical" fantasies that have failed completely. I think China has reeducated us and has taught us their approach is the most correct approach to post-capitalism. There isn't actually another correct way to do socialism, and the more time we waste the closer we come to American fascism and ecological collapse.
R: 16 / I: 1
Anarchism and production
So how, exactly, would production of advanced goods like aircraft carriers happen in an Anarchist world? Surely producing them would be so difficult you would need some form of top-down planning to create such things, no?
R: 56 / I: 5
I fucking hate her
I hate her so much. But I do not know why. I tried to watch her videos to know whether I truly hat her, but I can't make it past 5 minutes. The way she speaks is so fucking annoying. It's like she's my owner and she is giving me orders. She is secretly a nazi and a slave owner. I know it. That bitch is dangerous. My sixth sense is making me hate her as a defence mechanism.
R: 12 / I: 2
I noticed there is no thread for France related shit. So let this be one. French people deserve a safe space and guarantees for their continued existence on loser imageboards!
J'ai remarqué qu'il n'y a pas de thread dedié pour la France, alors que les salauds américains et anglais en ont des centaines. Français, ne succombez pas à l'impérialisme anglochiotte!
Subjets of Macronpiter, leave a post.
/FrancoPol/ 🇫🇷
🇫🇷🇫🇷🇫🇷 Aux armes, citoyens ! 🇫🇷🇫🇷🇫🇷I noticed there is no thread for France related shit. So let this be one. French people deserve a safe space and guarantees for their continued existence on loser imageboards!
J'ai remarqué qu'il n'y a pas de thread dedié pour la France, alors que les salauds américains et anglais en ont des centaines. Français, ne succombez pas à l'impérialisme anglochiotte!
Subjets of Macronpiter, leave a post.
R: 3 / I: 0
i think leftypol should have a porn/nsfw board in order to contain it and keep it out of siberia; i've noticed that porn posting is increasing again after it sort of stopped post-blackout, so it might be good to separate it from the rest of the site instead of shitting up siberia. just an idea
i think leftypol should have a porn/nsfw board in order to contain it and keep it out of siberia; i've noticed that porn posting is increasing again after it sort of stopped post-blackout, so it might be good to separate it from the rest of the site instead of shitting up siberia. just an idea
R: 68 / I: 24
im sick of the machismo in rapeporn, why can't i just authentically want to rape somebody without it being caused by some "crisis of masculinity"? its such bullshit
anyways… got some recs for good rapey stuff? post it!
im sick of the machismo in rapeporn, why can't i just authentically want to rape somebody without it being caused by some "crisis of masculinity"? its such bullshit
anyways… got some recs for good rapey stuff? post it!
R: 83 / I: 25 >>1950708
PARTIES:
>https://communist-party.ca/
>https://cpcml.ca/
>https://www.marxist.ca/
Fuck flood detection
>https://ncpc-npcc.ca/
>https://www.democraticsocialists.ca/
>https://iww.ca/
>https://socialistaction.ca/
NEWS:
>https://pvonline.ca/
>https://springmag.ca/
>https://canadiandimension.com/
Canada Thread 2: People's Republic of Carney
Previous thread:PARTIES:
>https://communist-party.ca/
>https://cpcml.ca/
>https://www.marxist.ca/
Fuck flood detection
>https://ncpc-npcc.ca/
>https://www.democraticsocialists.ca/
>https://iww.ca/
>https://socialistaction.ca/
NEWS:
>https://pvonline.ca/
>https://springmag.ca/
>https://canadiandimension.com/
R: 22 / I: 26
The regulation of female pubic hair is not merely an aesthetic preference, but an expression of capitalist commodification and patriarchal control. The love of pubic hair is an expression of proletarian culture—a rejection of capitalist infantilization and the forced sexualization of childlike bodies.
In primitive communities without private property, pubic hair was universal and unquestionable, and there was no ideological apparatus for its removal. Women existed in their natural state, without aesthetic coercion.
With the advent of private property, the ruling classes imposed an aesthetic discipline on women. Hair removal became a bourgeois practice associated with the nobility and subordination, while working-class women retained their natural state. Thus pubic hair became an object of class struggle.
Capitalism enforces cultural hegemony, creating an artificial sense of shame around pubic hair to sustain industries that profit from insecurity. The fetishization of hairlessness infantilizes women, reinforcing male dominance and perpetuating consumer society.
The proletarian revolution dismantles capitalist aesthetic norms, restoring bodily autonomy and rejecting the shame imposed on women. Under communism, pubic hair will no longer be an object of struggle, but a symbol of true freedom—free from control, commodification, and capitalist influence.
The regulation of female pubic hair is not merely an aesthetic preference, but an expression of capitalist commodification and patriarchal control. The love of pubic hair is an expression of proletarian culture—a rejection of capitalist infantilization and the forced sexualization of childlike bodies.
In primitive communities without private property, pubic hair was universal and unquestionable, and there was no ideological apparatus for its removal. Women existed in their natural state, without aesthetic coercion.
With the advent of private property, the ruling classes imposed an aesthetic discipline on women. Hair removal became a bourgeois practice associated with the nobility and subordination, while working-class women retained their natural state. Thus pubic hair became an object of class struggle.
Capitalism enforces cultural hegemony, creating an artificial sense of shame around pubic hair to sustain industries that profit from insecurity. The fetishization of hairlessness infantilizes women, reinforcing male dominance and perpetuating consumer society.
The proletarian revolution dismantles capitalist aesthetic norms, restoring bodily autonomy and rejecting the shame imposed on women. Under communism, pubic hair will no longer be an object of struggle, but a symbol of true freedom—free from control, commodification, and capitalist influence.
R: 3 / I: 1
-Christian "anarchist" reactionary faggot
-Syndicalist flag retard
-(3) Three Conservative Stalinists against fun
-Porn Wankers
-Primitivist ultra-reactionary /pol/yp
-Maoist
-Soyjak poster
-The Mods who allow all of the above
Left of capital, pretty much united.
Slower than a snail
This stagnation is sponsored by:-Christian "anarchist" reactionary faggot
-Syndicalist flag retard
-(3) Three Conservative Stalinists against fun
-Porn Wankers
-Primitivist ultra-reactionary /pol/yp
-Maoist
-Soyjak poster
-The Mods who allow all of the above
Left of capital, pretty much united.
R: 4 / I: 1
look at this ai generated image of me, it looks real just like me irl lookk at it its almost like real lief, its so life like just like me fr fr size accurate too btw
look at this ai generated image of me, it looks real just like me irl lookk at it its almost like real lief, its so life like just like me fr fr size accurate too btw
R: 11 / I: 0
Is gender identity inherently subversive of leftist ideals?
Is it neoliberal in practice?
Any and all resources appreciated
Is gender identity inherently subversive of leftist ideals?
Is it neoliberal in practice?
Any and all resources appreciated
R: 45 / I: 12
It's truly over. Unless western culture is changed at the grass roots level AND THEN politically promoted, no communism will ever come to the west. You cannot build communism in a society where the "individual" is some weird fetish that is a fake parody of itself from renaissance thought of 600 years ago.
>inb4 counter examples of collectivist pockets in western societies.
>inb4 helping chinese paratroopers when they land in the midwest
>inb4 mamadani
you had a higher chance of building communism in ancient egypt with the pharaohs as stalin then you do now in the west
Genesis 41:25-57
Deep Dark Truth
>0 protestant countries with organic communist revolutionsIt's truly over. Unless western culture is changed at the grass roots level AND THEN politically promoted, no communism will ever come to the west. You cannot build communism in a society where the "individual" is some weird fetish that is a fake parody of itself from renaissance thought of 600 years ago.
>inb4 counter examples of collectivist pockets in western societies.
>inb4 helping chinese paratroopers when they land in the midwest
>inb4 mamadani
you had a higher chance of building communism in ancient egypt with the pharaohs as stalin then you do now in the west
Genesis 41:25-57
R: 6 / I: 1
Support the Brazilian-British-Chinese (BBC) axis against the evil imperial powers of the US, Argentina, and Ireland (USAID)
god bless comrades. dont let them lie to U ok
Support the Brazilian-British-Chinese (BBC) axis against the evil imperial powers of the US, Argentina, and Ireland (USAID)
god bless comrades. dont let them lie to U ok
R: 26 / I: 1
Beyond his political opinions, how can someone banalise rape like this? It's like a school yard joke to him, his whole "I will assrape XYZ" schtick must be an instant ban. I am also not surprised that he is into little girl cartoon porn which he posted in /siberia/.
Jannies will ban people for nonsense idpol or 'hyper sectarianism', but allow such a degenerate retard to spit his venom here.
Death to Rapefiend!
JANNIES DO YOUR JOB--BAN RAPEFIEND
Mods are too lenient with the animal that is RapefiendBeyond his political opinions, how can someone banalise rape like this? It's like a school yard joke to him, his whole "I will assrape XYZ" schtick must be an instant ban. I am also not surprised that he is into little girl cartoon porn which he posted in /siberia/.
Jannies will ban people for nonsense idpol or 'hyper sectarianism', but allow such a degenerate retard to spit his venom here.
Death to Rapefiend!
R: 30 / I: 7
We all may differ in various ways and beliefs but our fundamental goals are the same, and we share a common enemy in the bourgeoisie - so why can’t we get along until they have been defeated?
And no insults disguised as compliments! Nice things only!
Left unity thread
In this thread, say something nice about your fellow leftist factions: mls say something nice about trotskyists, maoists say something nice about anarchists, etcWe all may differ in various ways and beliefs but our fundamental goals are the same, and we share a common enemy in the bourgeoisie - so why can’t we get along until they have been defeated?
And no insults disguised as compliments! Nice things only!
R: 0 / I: 0
you know 4chan has became mickey mouse because every single greentext that dorks repost onto other sites got reddit spacing now, some even just lazily edit an existing screenshot in paint or whatever it is that kids use these days to add their opinion in greentext format because they unironically believe that it was posted on The 4chan gives their opinion more weight lmao
you know 4chan has became mickey mouse because every single greentext that dorks repost onto other sites got reddit spacing now, some even just lazily edit an existing screenshot in paint or whatever it is that kids use these days to add their opinion in greentext format because they unironically believe that it was posted on The 4chan gives their opinion more weight lmao
R: 468 / I: 332
Post anything furry-related, be it artwork, stories, videos, music or whatever else you might find interesting with animal people in it. Scalies, avians, insectoids, synths, aeromorphs and such also appreciated.
Furry thread 2: Siberian Boogaloo
Because the previous one has hit the bump limit, and the succeeding thread was sadly lost in the crash of 2024.Post anything furry-related, be it artwork, stories, videos, music or whatever else you might find interesting with animal people in it. Scalies, avians, insectoids, synths, aeromorphs and such also appreciated.
R: 1 / I: 0
>Zukowski reckons that's just not the issue: "The reason Steam makes indies so much money compared to all the other platforms is that they have built up an audience that is full of super die-hard hobbyists… Basically, hobbyists buy stuff not because they actually want to consume it, but because they are collecting it."
>This is illustrated by the so-called "pile of shame" from various hobbies: great stacks of Lego sets waiting to be built; a room crammed with Warhammer model kits; the Everest-like mounds of yarn that knitters call their "stash." Apparently the Japanese even have a word for those who buy books and pile them up knowing they won't read them: "tsundoku."
treatlerism is a mental disease
>Zukowski reckons that's just not the issue: "The reason Steam makes indies so much money compared to all the other platforms is that they have built up an audience that is full of super die-hard hobbyists… Basically, hobbyists buy stuff not because they actually want to consume it, but because they are collecting it."
>This is illustrated by the so-called "pile of shame" from various hobbies: great stacks of Lego sets waiting to be built; a room crammed with Warhammer model kits; the Everest-like mounds of yarn that knitters call their "stash." Apparently the Japanese even have a word for those who buy books and pile them up knowing they won't read them: "tsundoku."
treatlerism is a mental disease
R: 136 / I: 64
Fashion thread V
Previous thread: >>36889
R: 21 / I: 2
During COVID, the PMC suddenly got way more autonomy. Remote work gave them freedom to work from anywhere, set their own hours, and basically ignore old-school workplace control. Plus, they used their cultural clout to push for """woke""" causes. On top of that, the great resignation gave them serious leverage to demand raises and better conditions.
From the capitalist perspective, this looked like the PMC getting a bit too big for their britches, acting like stakeholders instead of wage workers.
Now enter generative AI. This isn’t just some productivity tool, it's capital’s answer to reclaiming control. By automating complex knowledge work like writing, coding, and design, AI threatens to replace or deskill the very roles the PMC has dominated. It lets capital reassert power by commoditizing intellectual labor and cutting out the "middleman."
In short: generative AI is a disciplinary tool, a trump card capital is playing to discipline an uppity PMC and take back the reins.
It's Capital's final anti PMC NUKE (if it works, which isn't guaranteed)
GenAI - Capital's anti PMC NUKE
The pandemic really shifted the balance between capital and knowledge workers like engineers, consultants, marketers, and academics who don’t own capital but wield a lot of influence - the so called PMC.During COVID, the PMC suddenly got way more autonomy. Remote work gave them freedom to work from anywhere, set their own hours, and basically ignore old-school workplace control. Plus, they used their cultural clout to push for """woke""" causes. On top of that, the great resignation gave them serious leverage to demand raises and better conditions.
From the capitalist perspective, this looked like the PMC getting a bit too big for their britches, acting like stakeholders instead of wage workers.
Now enter generative AI. This isn’t just some productivity tool, it's capital’s answer to reclaiming control. By automating complex knowledge work like writing, coding, and design, AI threatens to replace or deskill the very roles the PMC has dominated. It lets capital reassert power by commoditizing intellectual labor and cutting out the "middleman."
In short: generative AI is a disciplinary tool, a trump card capital is playing to discipline an uppity PMC and take back the reins.
It's Capital's final anti PMC NUKE (if it works, which isn't guaranteed)
R: 7 / I: 0
Every time I attend any sort of gay event, I basically just end up walking around and watching other people do things because I'm too stiff and weird to be a cool gay guy.
Despite the memes about queer people being autistic, all rhe other autists I meet IRL are all straight. And though they can be nice, I perceive the world through such a fundamentally homosexual lense that I can't possibly be close with them.
I don't know what to do. Forget a boyfriend, I just want gay friends.
Is it actually possible to build relationships as a gay autist?
Queer culture is very casual and instinctive—"vibes-based", if you will—, which makes it near-impossible for those of us who are socially disabled to actually navigate its intricacies.Every time I attend any sort of gay event, I basically just end up walking around and watching other people do things because I'm too stiff and weird to be a cool gay guy.
Despite the memes about queer people being autistic, all rhe other autists I meet IRL are all straight. And though they can be nice, I perceive the world through such a fundamentally homosexual lense that I can't possibly be close with them.
I don't know what to do. Forget a boyfriend, I just want gay friends.
R: 1 / I: 0
Siberia
** 起来，饥寒交迫的奴隶！
起来，全世界受苦的人！
满腔的热血已经沸腾，
要为真理而斗争！
旧世界打个落花流水，
奴隶们起来，起来！
不要说我们一无所有，
我们要做天下的主人！
[副歌:]
这是最后的斗争，
团结起来到明天，
英特纳雄耐尔
就一定要实现！(x2)
从来就没有什么救世主，
也不靠神仙皇帝！
要创造人类的幸福，
全靠我们自己！
我们要夺回劳动果实，
让思想冲破牢笼！
快把那炉火烧得通红，
趁热打铁才能成功！
[副歌]
是谁创造了**
Siberia
** 起来，饥寒交迫的奴隶！
起来，全世界受苦的人！
满腔的热血已经沸腾，
要为真理而斗争！
旧世界打个落花流水，
奴隶们起来，起来！
不要说我们一无所有，
我们要做天下的主人！
[副歌:]
这是最后的斗争，
团结起来到明天，
英特纳雄耐尔
就一定要实现！(x2)
从来就没有什么救世主，
也不靠神仙皇帝！
要创造人类的幸福，
全靠我们自己！
我们要夺回劳动果实，
让思想冲破牢笼！
快把那炉火烧得通红，
趁热打铁才能成功！
[副歌]
是谁创造了**
R: 67 / I: 7
i resent having to add additional content to this post because it weighs down what would otherwise be a potent sentence.
uh oh
guys i don't want to alarm you or anything but i think the anti-femboy movement is a little bourgeoisi resent having to add additional content to this post because it weighs down what would otherwise be a potent sentence.
R: 155 / I: 39
I have seen many interesting input from various anons on Stalin here, whether in the form of opinions, books, documentaries etc. They happen sporadically, scattered on different threads which rarely have anything to do with Stalin, ML or USSR. I figured a Stalin General Thread would be useful. A place where to share all things Stalin and discuss all things Stalin.
Though I am pro-Stalin, this is not a strictly Stalin-worship thread. Posts critical of Stalin too are welcome. I simply request that they are in good faith, and not just 'muh ML' trolls.
/koba/ - Iosef Vissarianovich Stalin Generał #1
Thank you for everything, Joseph <3I have seen many interesting input from various anons on Stalin here, whether in the form of opinions, books, documentaries etc. They happen sporadically, scattered on different threads which rarely have anything to do with Stalin, ML or USSR. I figured a Stalin General Thread would be useful. A place where to share all things Stalin and discuss all things Stalin.
Though I am pro-Stalin, this is not a strictly Stalin-worship thread. Posts critical of Stalin too are welcome. I simply request that they are in good faith, and not just 'muh ML' trolls.
R: 30 / I: 28
I draw on occasion, mainly my OC Zhenya (aspiring femboy with black hair, when he transforms it's pink) and sometimes Dina (his tomboy classmate and first real friend in this bitch of a conservative school)
This is an art trade thread, so exchange doodles or full-blown drawings, or just share what you've drawn, even though this is more of a personal art dump :>
Art Trade Thread v2.0
/leftypol/ has been nuked Edition (Remade the thread because of it)I draw on occasion, mainly my OC Zhenya (aspiring femboy with black hair, when he transforms it's pink) and sometimes Dina (his tomboy classmate and first real friend in this bitch of a conservative school)
This is an art trade thread, so exchange doodles or full-blown drawings, or just share what you've drawn, even though this is more of a personal art dump :>
R: 8 / I: 0
I wanted to know what is your opinion on the so-called 'Queen of Breadtube' KKKontraPointSS?
Critique of the Critical Contracritique
Hello Lesbian Stalinists, Gay Trotskyists, Trans-Anarchists and Bi-Maoists, I hope you're doing well !I wanted to know what is your opinion on the so-called 'Queen of Breadtube' KKKontraPointSS?
R: 270 / I: 70 (sticky)
We are currently working on improvements to the site, subject to the need of the tech team to sleep and go to their day jobs. If you need more immediate feedback please join the matrix room[s] and ask around. Feel free to leave comments, concerns, and suggestions about the tech side of the site here and we will try to get to it as soon as possible
/ttg/ - Tech Team General
This thread is only for feedback related to technical issues (bug reports, suggestions).We are currently working on improvements to the site, subject to the need of the tech team to sleep and go to their day jobs. If you need more immediate feedback please join the matrix room[s] and ask around. Feel free to leave comments, concerns, and suggestions about the tech side of the site here and we will try to get to it as soon as possible
R: 597 / I: 57 >>1946727
Dump all the seemingly pointless, dubious, and frivolous questions that don't deserve their own shitty threads.
Got a question that's probably been asked a million times before? You're in the right landfill, buddy. Post it here.
Threads that otherwise might go in here will eventually find themselves become merged to this thread.
/QTDDTOT/ Questions That Don't Deserve Their Own Thread
Previous thread:Dump all the seemingly pointless, dubious, and frivolous questions that don't deserve their own shitty threads.
Got a question that's probably been asked a million times before? You're in the right landfill, buddy. Post it here.
Threads that otherwise might go in here will eventually find themselves become merged to this thread.
R: 418 / I: 65
Is this really it? Some policemen announced that they won’t be going to work tomorrow and that they have no intention of beating up children. This might be the only chance that the opposition gets to forcefully remove the president from office.
The implications are obvious; a color revolution is in the works. Unlike the protests in Greece, the Serbian protests have no class character. The left is very weak, and the protest attendees range from neonazis to liberals and communists (most likely due to the fact the protests have been organized “apolitically”). The situation in Serbia is very volatile, and the validity of these protests need to be questioned more seriously, since no matter how much they deny it, this reeks of liberal infighting. Only time will tell what the consequences of these past few months will be, and whether this will be another October 5th or just a failed mass movement.
March 15th, Belgrade Serbia
Tomorrow a huge protest will be held in the capital of Serbia, Belgrade, protesting the government’s refusal to accept the demands made by the students, as well as protesting against general incompetence and corruption. From the student to the teacher, worker and pensioner, war veterans and children all around Serbia will gather together in this protest.Is this really it? Some policemen announced that they won’t be going to work tomorrow and that they have no intention of beating up children. This might be the only chance that the opposition gets to forcefully remove the president from office.
The implications are obvious; a color revolution is in the works. Unlike the protests in Greece, the Serbian protests have no class character. The left is very weak, and the protest attendees range from neonazis to liberals and communists (most likely due to the fact the protests have been organized “apolitically”). The situation in Serbia is very volatile, and the validity of these protests need to be questioned more seriously, since no matter how much they deny it, this reeks of liberal infighting. Only time will tell what the consequences of these past few months will be, and whether this will be another October 5th or just a failed mass movement.
R: 322 / I: 67
Reading
Towards a New Socialism by Paul Cockshott and Allin Cottrell: http://ricardo.ecn.wfu.edu/~cottrell/socialism_book/
Brain of the Firm by Stafford Beer
Cybernetic Revolutionaries by Eden Medina
Cybernetics: Or the Control and Communication in the Animal and the Machine and The Human Use of Human Beings (1st edition) by Norbert Wiener
Economic cybernetics by Nikolay Veduta
People's Republic of Walmart by Leigh Phillips and Michal Rozworski
Red Plenty by Francis Spufford
Economics in kind, Total socialisation and A system of socialisation by Otto Neurath (Incommensurability, Ecology, and Planning: Neurath in the Socialist Calculation Debate by Thomas Uebel provides a summary)
Active writers/creators
Sorted by last name
>Paul Cockshott
https://www.patreon.com/williamCockshott/
https://www.youtube.com/channel/UCVBfIU1_zO-P_R9keEGdDHQ (https://invidious.snopyta.org/channel/UCVBfIU1_zO-P_R9keEGdDHQ)
https://paulcockshott.wordpress.com/
http://paulcockshott.co.uk/
https://twitter.com/PaulCockshott (https://nitter.pussthecat.org/PaulCockshott)
>Cibcom (Spanish)
https://cibcom.org/
https://twitter.com/cibcomorg (https://nitter.pussthecat.org/cibcomorg)
https://www.youtube.com/channel/UCav9ad3TMuhiWV6yP5t2IpA (https://invidious.snopyta.org/channel/UCav9ad3TMuhiWV6yP5t2IpA)
>Tomas Härdin
https://www.haerdin.se/tag/cybernetics.html
https://www.youtube.com/channel/UC5fDgA_eHleDiTLC5qb5g8w (https://invidious.snopyta.org/channel/UC5fDgA_eHleDiTLC5qb5g8w)
>Elena Veduta
http://www.strategplan.com/en/about/veduta.php
Various videos on YouTube but no channel of her own
>Dave Zachariah
https://www.it.uu.se/katalog/davza513
One video on Paul Cockshott's channel
Podcasts
>General Intellect Unit
Podcast of the Cybernetic Marxists
http://generalintellectunit.net/
Previous threads in chronological order
https://archive.is/uNCEY
https://web.archive.org/web/20201218152831/https://bunkerchan.xyz/leftypol/res/997358.html
https://archive.ph/uyggp
https://archive.is/xBFYY
https://archive.ph/Afx5a
https://archive.is/kAPvR
https://archive.is/0sAS2
https://archive.is/jXivP
/CYBERCOM/
This thread is for the discussion of cybercommunism, the planning of the socialist economy by computerized means, including discussions of related topics and creators. Drama belongs in /isg/Reading
Towards a New Socialism by Paul Cockshott and Allin Cottrell: http://ricardo.ecn.wfu.edu/~cottrell/socialism_book/
Brain of the Firm by Stafford Beer
Cybernetic Revolutionaries by Eden Medina
Cybernetics: Or the Control and Communication in the Animal and the Machine and The Human Use of Human Beings (1st edition) by Norbert Wiener
Economic cybernetics by Nikolay Veduta
People's Republic of Walmart by Leigh Phillips and Michal Rozworski
Red Plenty by Francis Spufford
Economics in kind, Total socialisation and A system of socialisation by Otto Neurath (Incommensurability, Ecology, and Planning: Neurath in the Socialist Calculation Debate by Thomas Uebel provides a summary)
Active writers/creators
Sorted by last name
>Paul Cockshott
https://www.patreon.com/williamCockshott/
https://www.youtube.com/channel/UCVBfIU1_zO-P_R9keEGdDHQ (https://invidious.snopyta.org/channel/UCVBfIU1_zO-P_R9keEGdDHQ)
https://paulcockshott.wordpress.com/
http://paulcockshott.co.uk/
https://twitter.com/PaulCockshott (https://nitter.pussthecat.org/PaulCockshott)
>Cibcom (Spanish)
https://cibcom.org/
https://twitter.com/cibcomorg (https://nitter.pussthecat.org/cibcomorg)
https://www.youtube.com/channel/UCav9ad3TMuhiWV6yP5t2IpA (https://invidious.snopyta.org/channel/UCav9ad3TMuhiWV6yP5t2IpA)
>Tomas Härdin
https://www.haerdin.se/tag/cybernetics.html
https://www.youtube.com/channel/UC5fDgA_eHleDiTLC5qb5g8w (https://invidious.snopyta.org/channel/UC5fDgA_eHleDiTLC5qb5g8w)
>Elena Veduta
http://www.strategplan.com/en/about/veduta.php
Various videos on YouTube but no channel of her own
>Dave Zachariah
https://www.it.uu.se/katalog/davza513
One video on Paul Cockshott's channel
Podcasts
>General Intellect Unit
Podcast of the Cybernetic Marxists
http://generalintellectunit.net/
Previous threads in chronological order
https://archive.is/uNCEY
https://web.archive.org/web/20201218152831/https://bunkerchan.xyz/leftypol/res/997358.html
https://archive.ph/uyggp
https://archive.is/xBFYY
https://archive.ph/Afx5a
https://archive.is/kAPvR
https://archive.is/0sAS2
https://archive.is/jXivP
R: 7 / I: 1 (sticky)
An FAQ including formatting and style guide and simplified rules can be found here: https://leftypol.org/faq.html & https://leftypol.org/rules.html
For technical issues use >>>/meta/34491
Dispute bans using the ban appeal form or >>>/meta/34464
Read This Before Posting:
If this is your first visit, lurk for a while before posting. /leftypol/ is an imageboard for non-sectarian leftist political discussion. The staff aims to allow everything within these bounds. To that end there are some critical rules (for /leftypol/):
* No Spam
* No New Threads for Topics with an existing General thread (e.g. USA politics, COVID-19, online personalities, etc.)
* No Reactionary or Identity Politics
* No Explicit Images including Porn without spoiler warning
Low quality threads are subject to be anchored or locked at volunteers discretion.
You may dispute actions taken by the staff or offer suggestions in >>>/meta/
Useful Links:
Search function - Find your favorite (or least favorite) posts!
https://leftypol.org/search.php
Leftypol Twitter - Follow us on Twitter for status updates and leftist memes
https://twitter.com/leftypol_org
Leftypol TikTok - Because this place is not giving you enough dopamine rushes
https://www.tiktok.com/@leftypol_org
/leftypol/ Cytube Community - Watch news, riot porn, or movies with comrades!
https://tv.leftypol.org
Onion Link - Connect anonymously via Onion!
http://ojzfy6mtnjkg4pbkf6fjnty22naczpek253skjm4crwftbohwgevbjyd.onion
Board Logs - Global and /leftypol/ logs
https://leftypol.org/log.php?board=leftypol
Matrix Congress - Public Moderation Room
NOTE: Due to recent cyber-attacks, please ask for an invitation to the congress in the public waiting room: https://matrix.to/#/#leftypolantechamber:matrix.org
https://matrix.to/#/!nTwQxlnWchxZsgDAgE:matrix.org?via=matrix.org
Matrix General Chat - Leftypol General Chat
https://matrix.to/#/#leftypol-antechamber:matrix.org
If you don't want to use matrix you can interact with the chat through #[email protected] too.
Leftybooru - To upload, tag, and organize images
https://lefty.pictures/
Leftypedia - A wiki project
-coming soon-
Welcome Thread
Search the catalog before starting a new thread to avoid duplicates: https://www.leftypol.org/leftypol/catalog.htmlAn FAQ including formatting and style guide and simplified rules can be found here: https://leftypol.org/faq.html & https://leftypol.org/rules.html
For technical issues use >>>/meta/34491
Dispute bans using the ban appeal form or >>>/meta/34464
Read This Before Posting:
If this is your first visit, lurk for a while before posting. /leftypol/ is an imageboard for non-sectarian leftist political discussion. The staff aims to allow everything within these bounds. To that end there are some critical rules (for /leftypol/):
* No Spam
* No New Threads for Topics with an existing General thread (e.g. USA politics, COVID-19, online personalities, etc.)
* No Reactionary or Identity Politics
* No Explicit Images including Porn without spoiler warning
Low quality threads are subject to be anchored or locked at volunteers discretion.
You may dispute actions taken by the staff or offer suggestions in >>>/meta/
Useful Links:
Search function - Find your favorite (or least favorite) posts!
https://leftypol.org/search.php
Leftypol Twitter - Follow us on Twitter for status updates and leftist memes
https://twitter.com/leftypol_org
Leftypol TikTok - Because this place is not giving you enough dopamine rushes
https://www.tiktok.com/@leftypol_org
/leftypol/ Cytube Community - Watch news, riot porn, or movies with comrades!
https://tv.leftypol.org
Onion Link - Connect anonymously via Onion!
http://ojzfy6mtnjkg4pbkf6fjnty22naczpek253skjm4crwftbohwgevbjyd.onion
Board Logs - Global and /leftypol/ logs
https://leftypol.org/log.php?board=leftypol
Matrix Congress - Public Moderation Room
NOTE: Due to recent cyber-attacks, please ask for an invitation to the congress in the public waiting room: https://matrix.to/#/#leftypolantechamber:matrix.org
https://matrix.to/#/!nTwQxlnWchxZsgDAgE:matrix.org?via=matrix.org
Matrix General Chat - Leftypol General Chat
https://matrix.to/#/#leftypol-antechamber:matrix.org
If you don't want to use matrix you can interact with the chat through #[email protected] too.
Leftybooru - To upload, tag, and organize images
https://lefty.pictures/
Leftypedia - A wiki project
-coming soon-
R: 171 / I: 47
<The great and authentic revolutionaries of the world are two: ᴉuᴉlossnW and Hitler. But ᴉuᴉlossnW's past shows that Il Duce has always been against the plutocracy and against the democracies, which paralyze the life of nations.
>Stalin, allying himself with London and Washington, has betrayed the cause of the proletariat. Moreover, I can say that on this I agree with Il Duce, when he says, as he did in his speech from last November, that if there is a man who desperately wanted the war, who first prepared it and then instigated it, it is the American president. From my point of view, however, I clarify that Roosevelt is nothing but the exponent of supercapitalism that aims at the conquest of a totalitarian imperialism.
Whaddafug, wholesome critical support to Hitler and ᴉuᴉlossnW????
What did Bordiga mean by this?
>Therefore, June 10 (the date of ᴉuᴉlossnW's declaration of war) was for me what you call a great day. But now that Hitler has grown soft, I begin to lose the trust I had placed in the Axis to strangle and pull down the so-called British colossus, that is, the greatest exponent of capitalism. They are afraid of bringing down England, they are afraid because they know that with it, the whole capitalist system will collapse. […] I still hope that Hitler will not renounce the struggle, and will go all the way, to the extreme consequences.<The great and authentic revolutionaries of the world are two: ᴉuᴉlossnW and Hitler. But ᴉuᴉlossnW's past shows that Il Duce has always been against the plutocracy and against the democracies, which paralyze the life of nations.
>Stalin, allying himself with London and Washington, has betrayed the cause of the proletariat. Moreover, I can say that on this I agree with Il Duce, when he says, as he did in his speech from last November, that if there is a man who desperately wanted the war, who first prepared it and then instigated it, it is the American president. From my point of view, however, I clarify that Roosevelt is nothing but the exponent of supercapitalism that aims at the conquest of a totalitarian imperialism.
Whaddafug, wholesome critical support to Hitler and ᴉuᴉlossnW????
R: 18 / I: 4
<Unpünktlich wie die Eisenbahn; verspätet auf maroden Strecken zu hohen Preisen: DB-Konzern überbietet jedes Jahr seine Negativrekorde
https://www.jungewelt.de/artikel/503080.versp%C3%A4tungen-bei-der-bahn-unp%C3%BCnktlich-wie-die-eisenbahn.html
<Rot gewinnt; Präsidentsschaftskandidatin in Chile ist von der KP
https://www.jungewelt.de/artikel/503066.kommunisten-rot-gewinnt.html
<Gideon Levy über Massaker der israelischen Armee an Hungernden in Gaza
https://www.jungewelt.de/artikel/503098.dokumentiert-gideon-levy-%C3%BCber-massaker-der-israelischen-armee-an-hungernden-in-gaza.html
<NATO-Manöver am Niederrhein: Kriegsvorbereitung statt Sicherheit
https://www.rf-news.de/2025/kw27/nato-manoever-am-niederrhein-kriegsvorbereitung-statt-sicherheit
<Parteitag der DKP
https://www.unsere-zeit.de/live-ticker-vom-26-parteitag-der-dkp/
<Maja T. ins Haftkrankenhaus verlegt
https://www.nd-aktuell.de/artikel/1192276.budapest-komplex-maja-t-in-haftkrankenhaus-verlegt.html
/leftydeutschpol/ - DB-Edition
Neuigkeiten<Unpünktlich wie die Eisenbahn; verspätet auf maroden Strecken zu hohen Preisen: DB-Konzern überbietet jedes Jahr seine Negativrekorde
https://www.jungewelt.de/artikel/503080.versp%C3%A4tungen-bei-der-bahn-unp%C3%BCnktlich-wie-die-eisenbahn.html
<Rot gewinnt; Präsidentsschaftskandidatin in Chile ist von der KP
https://www.jungewelt.de/artikel/503066.kommunisten-rot-gewinnt.html
<Gideon Levy über Massaker der israelischen Armee an Hungernden in Gaza
https://www.jungewelt.de/artikel/503098.dokumentiert-gideon-levy-%C3%BCber-massaker-der-israelischen-armee-an-hungernden-in-gaza.html
<NATO-Manöver am Niederrhein: Kriegsvorbereitung statt Sicherheit
https://www.rf-news.de/2025/kw27/nato-manoever-am-niederrhein-kriegsvorbereitung-statt-sicherheit
<Parteitag der DKP
https://www.unsere-zeit.de/live-ticker-vom-26-parteitag-der-dkp/
<Maja T. ins Haftkrankenhaus verlegt
https://www.nd-aktuell.de/artikel/1192276.budapest-komplex-maja-t-in-haftkrankenhaus-verlegt.html
R: 22 / I: 1
I reached mid 20s with barely any experience, autism made sure of that. Kissed a drunk lesbian once, I don't even think I looked that cute for a guy in his 20s, so I was honored more than anything. Broke up a friendship with a trans girl after some hasty choices, but she was crazy anyways. Now focusing on friends, making and deepening them.
Wish I had a man I understood and was understood by, someone light-hearted and whimsical to have fun with on the short time I have here on Earth. Femboy-ish ig, not masculine, but takes care of himself, with a touch of femininity to him. Impartial on sex, willing to do it, might be fun even.
One thing I like is the idea of relations as temporary, serial monogamy if you will. I'm all for loyalty while in a relation, but that doesn't necessarily mean it must be forever and ever. People change, why shouldn't their relations? Admittedly I do see the romance in a lifelong relation, sticking with someone and changing together with them. Besides looking for a new partner every x amount of years sounds exhausting.
Romance & Love thread
Figured I made a thread to share our romantic experiences – or lack of thereof, – opinions, wishes and advice. That is part of the whole LGBT experience besides the sex and gender.I reached mid 20s with barely any experience, autism made sure of that. Kissed a drunk lesbian once, I don't even think I looked that cute for a guy in his 20s, so I was honored more than anything. Broke up a friendship with a trans girl after some hasty choices, but she was crazy anyways. Now focusing on friends, making and deepening them.
Wish I had a man I understood and was understood by, someone light-hearted and whimsical to have fun with on the short time I have here on Earth. Femboy-ish ig, not masculine, but takes care of himself, with a touch of femininity to him. Impartial on sex, willing to do it, might be fun even.
One thing I like is the idea of relations as temporary, serial monogamy if you will. I'm all for loyalty while in a relation, but that doesn't necessarily mean it must be forever and ever. People change, why shouldn't their relations? Admittedly I do see the romance in a lifelong relation, sticking with someone and changing together with them. Besides looking for a new partner every x amount of years sounds exhausting.
R: 632 / I: 157 (full)
<Zionazis edition
Thread for the hellish discussion related to the scourge of the earth, the destroyer of nations, the king of coups, the sultan of sanctions, the emir of the embargo, the autocrat of austerity, the doge of deregulation, the baron of busting unions, the prince of privatization, the lord of loan sharks, the patron-saint of proxy wars, the sponsor of settlers, the guarantor of genocides, the Divided $nakkkes of Amerikkka™
🏈 💵 🌭 🍔
🛠️ Strike Tracker ⚒️
https://striketracker.ilr.cornell.edu/
🇺🇸 Deeds of the Burger Reich 🇺🇸
https://github.com/dessalines/essays/blob/main/us_atrocities.md
📺 Live News 📺
(sponsored by USAID)
• CNN: https://www.livenewsnow.com/american/cnn-news-usa.html
• MSNBC: https://www.livenewsnow.com/american/msnbc.html
• FOX: https://www.livenewsnow.com/american/fox-news-channel.html
• Bloomberg: https://www.bloomberg.com/live/us
✊ Live Protest Streams ✊
https://woke.net/
Epstein's Client List DOES NOT EXIST
https://epsteinsblackbook.com/
Previous Thread: >>2376287
/USApol/ 🇺🇸
🗽UNITED STATES POLITICS 🦅<Zionazis edition
Thread for the hellish discussion related to the scourge of the earth, the destroyer of nations, the king of coups, the sultan of sanctions, the emir of the embargo, the autocrat of austerity, the doge of deregulation, the baron of busting unions, the prince of privatization, the lord of loan sharks, the patron-saint of proxy wars, the sponsor of settlers, the guarantor of genocides, the Divided $nakkkes of Amerikkka™
🏈 💵 🌭 🍔
🛠️ Strike Tracker ⚒️
https://striketracker.ilr.cornell.edu/
🇺🇸 Deeds of the Burger Reich 🇺🇸
https://github.com/dessalines/essays/blob/main/us_atrocities.md
📺 Live News 📺
(sponsored by USAID)
• CNN: https://www.livenewsnow.com/american/cnn-news-usa.html
• MSNBC: https://www.livenewsnow.com/american/msnbc.html
• FOX: https://www.livenewsnow.com/american/fox-news-channel.html
• Bloomberg: https://www.bloomberg.com/live/us
✊ Live Protest Streams ✊
https://woke.net/
Epstein's Client List DOES NOT EXIST
https://epsteinsblackbook.com/
Previous Thread: >>2376287
R: 333 / I: 52 (sticky)
Previous thread >>>/leftypol_archive/580500
Archive of previous thread
https://archive.is/saN3S
Excuse me coming through
A quick note on the video @ >>>/leftypol/1538283
Also [vid related] for archival purposes
Around the 29 minute mark Peterson criticizes Marx and Engel's for assuming that workers would magically become more productive once they took over.
This actually happened historically, most of the actually effective productivity tricks work places use now were developed by Stakhanovites.
https://soviethistory.msu.edu/1936-2/year-of-the-stakhanovite/year-of-the-stakhanovite-texts/stalin-at-the-conference-of-stakhanovites/
Reality has a Marxist bias
/edu/ checkpoint
Everytime you visit /edu/, post in this thread. Tell us about what you're thinking about, what you're reading, an interesting thing you have learned today, anything! Just be sure to pop in and say hi.Previous thread >>>/leftypol_archive/580500
Archive of previous thread
https://archive.is/saN3S
Excuse me coming through
A quick note on the video @ >>>/leftypol/1538283
Also [vid related] for archival purposes
Around the 29 minute mark Peterson criticizes Marx and Engel's for assuming that workers would magically become more productive once they took over.
This actually happened historically, most of the actually effective productivity tricks work places use now were developed by Stakhanovites.
https://soviethistory.msu.edu/1936-2/year-of-the-stakhanovite/year-of-the-stakhanovite-texts/stalin-at-the-conference-of-stakhanovites/
Reality has a Marxist bias
R: 30 / I: 2
Hanna Reitsch was a luftwaffe test pilot who was also in the Fuhrerbunker in the days leading up to Hitler's suicide.
I recently watched the 2004 German Movie Der Untergang or Downfall, because it's been memed to death since the 00s because of a scene where Hitler crashes out and screeches at his general staff. People used to put fake subtitles over it. The movie Downfall is mostly from the perspective of Traudl Junge, but Hanna Reitsch also visits the bunker before Hitler offs himself.
I find these two women fascinating because neither of them were executed and they represent opposite mental strategies for handling the downfall of a fascist regime in which one is not only present and complicit, but an active participant.
Traudl copes: She always said in all her autobiographical work and interviews that she was young, she was merely a secretary, she didn't know what was going on, that she didn't realize what a monster Hitler was right away, etc. She was in her 20s. But in an interview very close to the end of her life she admitted: Her youthful inexperience and naivete were no excuse.
Hanna Reitsch on the other hand was never ashamed to be a nazi. She seethed after the war instead of coping. She always said that Germans were mostly still nazis, they just pretended otherwise because they lost. She would go around even until her death in the late 1970s wearing the diamond-studded iron cross Hitler had given her. She wanted to die in the fuhrer bunker with him while Traudl escaped through soviet lines when she had the chance.
If and when the the collapse of the major reactionary nations of today finally happens, will most people cope and pretend innocence like Traudl Junge, or will they openly seethe that they lost like Hanna Reitsch?
The Coping of Traudl Junge vs the Seething of Hanna Reitsch
Traudl Junge was Hitler's secretary and witness to his suicide in the Fuhrerbunker. A lot of our historical knowledge of what life was like in the Fuhrerbunker in the days leading up to Hitler's suicide, and the immediate aftermath, as the Soviets shelled and occupied Berlin, comes through her and a few other key witnesses.Hanna Reitsch was a luftwaffe test pilot who was also in the Fuhrerbunker in the days leading up to Hitler's suicide.
I recently watched the 2004 German Movie Der Untergang or Downfall, because it's been memed to death since the 00s because of a scene where Hitler crashes out and screeches at his general staff. People used to put fake subtitles over it. The movie Downfall is mostly from the perspective of Traudl Junge, but Hanna Reitsch also visits the bunker before Hitler offs himself.
I find these two women fascinating because neither of them were executed and they represent opposite mental strategies for handling the downfall of a fascist regime in which one is not only present and complicit, but an active participant.
Traudl copes: She always said in all her autobiographical work and interviews that she was young, she was merely a secretary, she didn't know what was going on, that she didn't realize what a monster Hitler was right away, etc. She was in her 20s. But in an interview very close to the end of her life she admitted: Her youthful inexperience and naivete were no excuse.
Hanna Reitsch on the other hand was never ashamed to be a nazi. She seethed after the war instead of coping. She always said that Germans were mostly still nazis, they just pretended otherwise because they lost. She would go around even until her death in the late 1970s wearing the diamond-studded iron cross Hitler had given her. She wanted to die in the fuhrer bunker with him while Traudl escaped through soviet lines when she had the chance.
If and when the the collapse of the major reactionary nations of today finally happens, will most people cope and pretend innocence like Traudl Junge, or will they openly seethe that they lost like Hanna Reitsch?
R: 179 / I: 15
/ career /
Career - job/career advice and other related stuff from a leftist perspective. EX: How to get a job, promotion, skill, switch companies, resume, life hacks, etc.
R: 25 / I: 7
<Hur dur centrally planned economies can not work!
Or something like that.
However what is it?
The capitalist propaganda is basically nonsense since is not every economy centrally planned? Do the capitalist corporations not have a board of directors who literally decide how many products to produce this year?
This quite often is countered with
<HUR DUR MUH FREE MARKET DECIDES
Or
<REAL CAPITALISM WAS NEVER TRIED
Any insight on the subject? Or is this a slur made up by the capitalists?
Centrally planned economy
So what is it? I see this phrase spammed from time to time in modern times in the style of<Hur dur centrally planned economies can not work!
Or something like that.
However what is it?
The capitalist propaganda is basically nonsense since is not every economy centrally planned? Do the capitalist corporations not have a board of directors who literally decide how many products to produce this year?
This quite often is countered with
<HUR DUR MUH FREE MARKET DECIDES
Or
<REAL CAPITALISM WAS NEVER TRIED
Any insight on the subject? Or is this a slur made up by the capitalists?
R: 500 / I: 171
Archive of the previous DPRK thread:
https://leftypol.org/leftypol_archive/res/12395.html
/DPRK/ - Democratic People's Republic of Korea General
Thread for news and discussions of the Democratic People's Republic of Korea, its material conditions, the status and health of its socialist tradition, disproving common myths about it, etc.Archive of the previous DPRK thread:
https://leftypol.org/leftypol_archive/res/12395.html
R: 28 / I: 7
these things feel genuinely satanic
body dbsjwkdkwdkwfiegkdkvqfkvqfkvqfkvkqrvkqfbkqf fk qdk qfk qfk qkfvkqfvkqf kqrk qfk qfk qkf kqf kqfk qfk qkf kqf k
these things feel genuinely satanic
body dbsjwkdkwdkwfiegkdkvqfkvqfkvqfkvkqrvkqfbkqf fk qdk qfk qfk qkfvkqfvkqf kqrk qfk qfk qkf kqf kqfk qfk qkf kqf k
R: 20 / I: 1
New to leftism. Why are trotskyists a laughingstock? Is it trotsky himself or some later development from the followers of his ideology? I've seen this everywhere in the online left
I have not much more to add beyond the question
New to leftism. Why are trotskyists a laughingstock? Is it trotsky himself or some later development from the followers of his ideology? I've seen this everywhere in the online left
I have not much more to add beyond the question
R: 17 / I: 1
>tfw my dream of a national bolshevik cybercommunist neorenaissance techohumanist soviet russian society that with a joint-military campaign with china nationalized all resources and assets in africa and reinvested it into the country while establishing the Slavic Economic Union aka new warsaw pact with all the eastern countries which makes all western countries have recessions and have to open trade with us in order to survive which in turn makes us richer and in turn makes us reinvest the riches into education and science to produce 200 autism score slavic ubermensch that invent an anti-gravity engine which revolutionizes transit and domestic industry to which we start launching spaceships to form a lunar colony on the moon to extract more resources for trade and industrialization which makes us the global superpower and vanguard lord for the next millennia of humanity will never come true
its over
>tfw my dream of a national bolshevik cybercommunist neorenaissance techohumanist soviet russian society that with a joint-military campaign with china nationalized all resources and assets in africa and reinvested it into the country while establishing the Slavic Economic Union aka new warsaw pact with all the eastern countries which makes all western countries have recessions and have to open trade with us in order to survive which in turn makes us richer and in turn makes us reinvest the riches into education and science to produce 200 autism score slavic ubermensch that invent an anti-gravity engine which revolutionizes transit and domestic industry to which we start launching spaceships to form a lunar colony on the moon to extract more resources for trade and industrialization which makes us the global superpower and vanguard lord for the next millennia of humanity will never come true
its over
R: 57 / I: 16
A leftcom subreddit is currently raiding us, if you wondered why there was such an influx of low quality posters derailing every thread with their mentally ill leftcom vs ML larp internet war.
A leftcom subreddit is currently raiding us, if you wondered why there was such an influx of low quality posters derailing every thread with their mentally ill leftcom vs ML larp internet war.