[ home / rules / faq / search ] [ overboard / sfw / alt ] [ leftypol / edu / labor / siberia / lgbt / latam / hobby / tech / games / anime / music / draw / AKM ] [ meta ] [ wiki / shop / tv / tiktok / twitter / patreon ] [ GET / ref / marx / booru ]

Catalog (/Off-topic/)

[ Create new thread ]
Name
Options
Subject
Comment
Flag
File
Embed
Password(For file deletion.)
What is 6 - 2?
Sort by: Image size:


R: 51 / I: 22 (sticky)

ANIMAL ELECTION RESULTS!!!!!!

BIRD and HEDGEHOG have WON the 2025 Animal Election!!!

Lets find out right now which one is going to be the president, and which will be the vice president by using the dice roll feature:
dice 1d2 = 1
If the number above is 1, then the president is BIRD
If the number above is 2, then the president is HEDGEHOG


The LOVECRAFTIAN party has won the most congress seats!!!

What does this mean for the future of our society?!?!??
R: 37 / I: 7

pizza cutter type mf containment thread

>glowing rape fiend be like
Rape is a serious crime and a traumatic experience that causes deep harm to victims. It's not something to joke about because it disrespects the pain and suffering of those affected. Jokes about rape can make survivors feel worse and can encourage harmful attitudes in society. People who make light of rape often don't realize the damage it causes. It's important to approach others with kindness and respect, especially in sensitive situations. We should be mindful of the impact our words can have, even if we don't fully understand it ourselves. This explanation focuses on the emotional and societal impact, making it easier to grasp, especially if empathy is difficult.
>uhhhhhh why are you moralizing my sadism bro
R: 1 / I: 0
4chan is so unbelievably singularly obsessed with transgender people it boggles the mind. How do they even live like that. Every board, every thread, every post, every day, for a decade. Setting aside the fact that it's wrong to be cruel to transgender people (and it is), I don't get why it takes up so much space in their brains, and why they bring it up so often. People in countries under attack don't talk about the invading nation as often or with as much rage as 4channers mention trans people. Why don't they get tired? What's wrong with them?
R: 5 / I: 0
I need a way to quickly, briefly, explain the moral and philosophical background ,of the behaviour I will start having; I'm EXTREMELY bitter\resentful\upset at the universe or reality, because I found out a neighbor's daughter flew to india because she's a model. so, she flew to india to do some retarded model s* photograph shoots. I can't quite cope or accept that WHY NOT ME, who flew to the magnificent india -country of celibate ascetics- for free, as she did.
So, I decided I will adopt in my real life, daily life the motto of : "i could literally die any day might as well live to the best possible level, be brave, daring and reckless—im on rock bottom, can't possible lose anything
How do I explain all this shit very quick, whence I'm questioned or put unto inspection for beheaviour irresponsibly with money, food, health, etc? among other possible disruptions of orderly life expected of societal humans.
R: 603 / I: 142 (full)

Sex and Relationship General 48

Summer romance Edition
Too short or empty Subedition
Still too short or empty Subsubedition
uygha are you fucking serious get your shit together mods its a fucking random board, you expect me to write a novel every time I want to make a thread Subsubsubedition

Previous thread: >>677469
R: 18 / I: 2

Longhouses were good, actually

The average "longhoused" Iroquis tribesman was a gigachad warrior who lived in an egalitarian tribe and had access to have SÉXO with multiple women in his tribe as long as they weren't part of his matrilineal gens. Compare that to the people who go around calling everyone "longhoused". The average ZOGged BAPtard who is a godcucked wagie who will never see a pussy in his life and will die of heart disease.
R: 97 / I: 56
im sick of the machismo in rapeporn, why can't i just authentically want to rape somebody without it being caused by some "crisis of masculinity"? its such bullshit

anyways… got some recs for good rapey stuff? post it!
R: 6 / I: 2
what would hitler do if he saw this video



penis too short penis too short penis too short penis too short penis too short penis too short penis too short
R: 67 / I: 12

Autistic Pride and Anti-Greg manifesto

Daily reminder that most NTs will always hate autists on a subconscious level no matter how hard you try to "mask". Don't let the bad NTs and the crabs (e.g. Gregs) tear you down.
I will NOT:
>mask
>engage in small talk
>look you in the eye
>keep up with the latest fashion and trends
I WILL:
>stim and fidget in public
>infodump about special interests
>walk on my toes
>speak in a flat affect
>have meltdowns whenever I am inconvenienced by normies in the slightest
>be my authentic self and you WILL put up with it
R: 57 / I: 3
How does one go about becoming an Old Order Mennonite?

I’m thinking about joining because I’ve realized their theology is by far the most consistent with both communism and Early Christianity (which was full communism in its truest sense). Unlike most other Christians, Old Order Mennonites actually practice communism by holding all possessions in common. They believe all land and wealth belong to God and God only. They do not work for the capitalist system but for their community. They also adhere to a consistent life ethic, meaning they are anti-war, anti-imperialist, anti-capitalist, anti-eugenics, anti-abortion, anti-death penalty, anti-gun, anti-euthanasia, you get the picture. They are also notorious pacifists who refuse to pay taxes to an imperialist, war-hungry government. That’s far more principled than the vast majority of “leftists” in the world.

I was raised Jewish and am largely disgusted by the fascism in the Jewish community regarding Palestine. Judaism is also anti-universalist at its core. I became Christian last year but realized I need more from my faith. The Old Order Mennonites are the only Christians who perfectly reflect the true teachings of Christ. So how do I join? What’s the process? Would they accept a former Jew like me?
R: 72 / I: 6
I went to a fair yesterday with my friends and got depressed because I saw how far behind everyone else I am. Everyone was with their partners, talking about work, and I'm a NEET autist. My best friend ended up flirting with a pretty girl for the first time in his life, and I was there and left pretty early. When I got home, I literally felt nauseous, didn't sleep at all, and today I've been crying constantly.

Not only I feel repulsive and that no one will ever like me, but also I feel like I wasted my life, I don't know what to do. I'm 24 and still a virgin and even though I kissed several girls I still feel I'm chopped.
R: 61 / I: 19

Digital Grass Checkpoint

Link to at least one website you didn't know about prior to today. If you don't have one, open up a new tab and explore until you find one.
R: 357 / I: 116

Friday

How are you spending this Friday? Do you have any plans for the weekend?
R: 105 / I: 113
can we have a small penis worship thread?

small penis worship thread

pls worship small penises here

The penis was too short or empty. The penis was too short or empty.
R: 426 / I: 1066

post porn

post porn post porn post porn post porn
please please please please please please please please
post porn post porn post porn post porn
please please please please please please please please
R: 337 / I: 267

Post Here Every time You Visit This Board

Post here every time you visit the board.
Also post Teto
R: 18 / I: 4
What would even be a reason to clean your room? I'm so lazy.



BLOG POST blog post blog post blog post blog post blog post blog post blog post blog post blog post blog post blog post blog post blog post blog post blog post. Blog post blog post blog post blog post blog post blog post blog post. Blog post blog post blog post blog post blog post blog post blog post. Blog post blog post blog post blog post blog post blog post blog post.
R: 16 / I: 4

🤔🤔🤔

if a pubic louse is transmitted during a sexual intercourse, is that pubic louse a victim of bestiality??? 🤔

if i pour boiling water on ants, am i a zoosadist??? 🤔

do you think tom cruise really pleasured himself with a live fish??? 🤔
R: 0 / I: 0

Prescriptions? Question

Why does places like cvs have prescription drop off safe places for free but not paid. I used to buy prescriptions right like a normal incel, but if cvs gave incentives like rebates for dropping off pills then it would def help with the issue. i have like 20 pill bottles with anywhere from a couple pills to a full dose of things like hiv meds, adderal, and other controlled substances not expired and expired. >my socialist solution: pharmacies offer $5 rebate per pill bottle. they would cross reference the bottle, the pills, and the patients id to make sure everything is good. but the bottle must have atleast one pill left.
>> im not stupid i know they can't reuse them but they costed me money and these autistic teenagers in my area will pay me like $5 per 10 mg for the stimulants so give me incentive to be a good person
R: 54 / I: 10

Complain about 4chan Thread

Complain about 4chan. It's not bannable on here.

I just got banned for some dumb shit so I'm seething I'll admit. Fucking pussy ass motherfucking cocksucking mod pieces of shit I hope they eat cat food for the rest of their days
R: 10 / I: 3
Anybody have the meme of this guy dressed in german military uniform saying “auslander raus”?

Body body body body body body body body body body body
R: 18 / I: 1
He was a based anti-anglo imperialism leftist, which is why he is demonised and portrayed as a tyrannical villain in angloid media/history

Change my mind
R: 9 / I: 4
"Lassalle was at the point of giving up his work as a failure, when he had the fortune of being shot." - Friedrich Engels, 1882
https://marxists.org/archive/marx/works/1882/letters/82_02_07.htm

Holy SHIT, what is it about Marx and Engels that they were so good at dissing others in the freaking 19th century?
R: 42 / I: 12

RACEPLAY PORN

the title says it all
Contribute whatever you can please
It can be about any race

yes I know Im a weirdo. Race taboo makes me ROCK HARD

the title says it all
Contribute whatever you can please

the title says it all
Contribute whatever you can please
R: 34 / I: 10

Board ecelebs thread

ITT: we notice some namefags and other notable posters who use this website. I will not be including myself (the luffy poster) because i am making the thread.

lets recognize
>Chihuahua poster
>Mr k.
>rapefiend
>The glownonymous with the recognizable post style that always posts in these threads
>The glownonymous who posts that they were raped every day in sex and relationships general
>The anon that always lectures me about what blackpill means
>gay misandrist
>The poster in sex and relationships general that publicly declares hes an incel that hates all women
>Quebecposter
>Shay
>christcom flag anon
>pirate flag anon
>grace chan
>DDRflag poster
>blackflag anon
>ancom flag poster
>4th international poster
>misato
>zankaria
>wvobbly
>FALKE
>mudah
>caballo
>sindikat
>newgene
>fed flag anon
>Sasuke anon

lets remember
>DRAINED poster
>thingnoticer
>baboon poster
>Junko
>Hoochie Minh
>Bat'ko
>Pierre Tru-Dank
>Muke/Xexizy
>8 leftypol bo
>penny/ralsei poster
>trans bpd anon
>eugenics kun/eugene
R: 194 / I: 323

420chan Culture Museum

Come and visit this thread! Users of leftypol, siberia, for the 420chan Culture Museum.
Here you can see an array of ancient and modern screenshots, that stem from the wonderful civilization of narcomania that inhabited the place once known as 420chan, a place that is promised to return one day.
Our unique collection of historical screenshots tells the story of human relations with psychoactive substances.

[WARNING: Some screenshots might contain NSFW content, viewer discretion is advised.]
R: 15 / I: 7

Pure happiness 😊 thread

Only happiness here. Post the most happy!😁

No uyghurtivity here, only happirtivity.

You have pure happiness pic or vid? This is the thread for it!

Don't be a ☹️ frowny face, be a 😍 happy face!

Don't let your threads be too short or empty, make them long (successful) and full (with love) 💕😘!
R: 24 / I: 5
>there are people that think voting changes things
>There are people that think boycotting changes things
>There are people that think petitions change things
>there are people that think letters to elected officials change things
>there are people that think recycling changes things
R: 118 / I: 175

Cat thread

Post cats, big n’ small

the body was too round and fluffy
the body was too round and fluffy
the body was too round and fluffy
the body was too round and fluffy
R: 23 / I: 5
Please tell me how to actually engage with and digest films. ADHD makes me feel like a retard who likes things just because and I'm incapable of putting things into words. I don't want to be the type of person who likes keys being jingled over their face.
R: 1 / I: 0

WTF is this. paramilitary buddhist cult?

>Dorje Kasung are practitioners of the Buddha Dharma and Shambhala Dharma, engaged in the Dorje Kasung teachings of protectorship, transmitted by Chögyam Trungpa Rinpoche.
>The ‘meditation-in-action’ practices of the Dorje Kasung are based on ancient Bodhisattva Warrior traditions, an opportunity to working with our own state of being, while serving all our relations and our world.
https://www.dorjekasung.com/
>https://shambhalatimes.org/2014/04/01/dorje-kasung-considering-compulsory-service-draft-swords/
from thr Shambhala Training "tradition" structure of programs, by Chogyam Trungpa Rinpoche.
so..an uniform-wearing, drill-doing, armed, ranked and iirc they also do martial arts or sword drills too, sub-group of an already kinda SUS lama's lineage..Are they harmless cosplayers? something more sinister, such as scientology's Sea Org? It seems like an overlooked yet fascinating rabbit hole.
R: 15 / I: 2
Any autists here? I'm recently more self aware of my lifelong tendency to repeat what other people said/wrote in my head as if it was my own independent observation, visualizing it like I had said it. And then I'll have little rants continuing from the point in my own head like it was my own point of view even if it wasn't. I'm usually not meta aware of this but recently I'm wondering if its related to autism or something to do with my mental processing of information. Or maybe I have a loose sense of self idk. Done this my whole life
R: 9 / I: 1
Mental health services are so fucking retarded and useless and I can't stand when idiots think they're being helpful by recommending them. They don't actually give a shit about you, it's just a job. You'd have better luck talking to the stripper who calls you her "favourite".
R: 60 / I: 118
alright, its time for a hentai thread, this is it.

post hentai, doujinshi, etchi, all different kinds, please keep it high quality and within the rules.
R: 58 / I: 3

I just dumped my gf because I don't find her attractive

So I've been dating a girl I met on Tinder for a few weeks. We started doing typical couple's stuff like holding hands, hugging, doing fun stuff like going shopping, to the beach etc. She said that she had never felt like this before and that she wanted to have a serious relationship and I played along.

Today I told her that I don't actually like her and I was with her because I didn't want to be lonely. She was devastated and I felt like shit because I saw she was so happy to see me. I even kissed her forehead in some of our dates, hugged and caressed her and I don't even know why. I feel horrible because she doesn't deserve this, she's so sweet and friendly but I don't really feel the same as her. It's honestly one of the worst things I've done to someone in my life.
R: 5 / I: 1

tropes in theory you hate

>1/4 of the book is an external author's introduction
>said intro writer is really opinionated and also wrong
>overused phrases like 'always already'
R: 30 / I: 4

thinking of wasting almost half my month's salary

thinking of wasting almost half my month's salary on a miyoo mini plus and a pandora RRTV arcade in a suitcase (picsrel)

opinions on this thread won't affect my choice, my choice depends on if I'm not too tired to make the call or if I start questioning if I will get bored with them and if its worth it
R: 487 / I: 353

Furry thread 2: Siberian Boogaloo

Because the previous one has hit the bump limit, and the succeeding thread was sadly lost in the crash of 2024.

Post anything furry-related, be it artwork, stories, videos, music or whatever else you might find interesting with animal people in it. Scalies, avians, insectoids, synths, aeromorphs and such also appreciated.
R: 279 / I: 426

Royal Colony 13

by invitation of bronies & Tania
<Avatard RP reactionary leech is oUr fWiEnD u GuIsE
R: 9 / I: 3
sometimes its about being sopping wet covered in a trillion rivulets with the sky electric blue and you get immediately launched across the void of space at infinite speed for eternity while on fire. but only sometimes
R: 1 / I: 0
everytime i post on the onion site i get RAPED by hcaptcha this thing is so slow and bloated its like an ugly bastard doujin, it takes like 30 seconds to load the thing and 30% of the time it just freezes tor browser completely, atleast i get to look at tiny images of frogs wearing hats or cats wearing glasses, unless its THAT STUPID FUKCING PIPE ONE i reallly hate that one i can never line the pipes up close enough to count. oh and it wants me to do two of them, but most of the time its like it crashes on the first one and restarts so i have to do like three or more captchas eveyr time i want to post , its TOTAL BULLSHIT
R: 29 / I: 5
if you haven't done 3 out of 12 of these, can you even call yourself an anarchist or a true NEET lumpenprole? i did them all today. i look like this and i did this
R: 24 / I: 1
I maintain my position that women are God‘s gift to men and that men have not a single real reason to hate women. If you disagree then you are suffering from an internal problem that women aren‘t responsible for.
R: 14 / I: 0
Lets assess the FACTS you LIBSHIT
>The Oklahoma City Bombing was FAKE
>9/11 was FAKE
>The planes were FAKE
>Sandy Hook was FAKE
>Boston Marathon Bombing was FAKE
>Orlando Nightclub Shooting was FAKE
>The Las Vegas Shooting was FAKE
>Charlottesville was FAKE
>The Parkland Shooting was FAKE
>Covid was FAKE
>George Floyd was FAKE
>Jan 6 was FAKE
What? You think this very clearly staged assassination attempt was FAKE? What are you some sort of deranged conspiracy theorist who thinks the government would LIE? Kill an innocent person as collateral? Do you really believe that the government has the requisite resources to get red stuff on Trumps hand? Fucking RETARD.
R: 27 / I: 6

Textboard .onion

Someone in the anti-TOR thread mentioned they would be interested in a leftypol-themed textboard, so i hacked one together over the last couple of days. http://ozlhzl2ufuyk7ovhg5mtzywiu6hevibr5xknrd64ge2qp4myjkzbgfqd.onion/tech
A weekly backup script is running and i will clean up once a day. Autolinking URLs coming soon…
R: 23 / I: 3
Dog, Democratic People's Republic of Korea
R: 132 / I: 26

I fucking hate her

I hate her so much. But I do not know why. I tried to watch her videos to know whether I truly hat her, but I can't make it past 5 minutes. The way she speaks is so fucking annoying. It's like she's my owner and she is giving me orders. She is secretly a nazi and a slave owner. I know it. That bitch is dangerous. My sixth sense is making me hate her as a defence mechanism.
R: 3 / I: 0
MAGAtards now with trump in the epstein files

The body was too short or empty. The body was too short or empty. The body was too short or empty.
R: 41 / I: 6
How the FUCK is a uygha supposed to lose weight when food tastes so good? No wonder everyone's on ozempic. You have to chain yourself in a dark closest and live off nothing but bread and water for months to lose weight.
R: 12 / I: 4
i didnt do anything this saturday

soon the weekend will end and i will have nothing to show for it


DIARY DIARY DIARY DIARY DIARY DIARY DIARY DIARY
DIARY DIARY DIARY DIARY DIARY DIARY DIARY DIARY
DIARY DIARY DIARY DIARY DIARY DIARY DIARY DIARY
DIARY DIARY DIARY DIARY DIARY DIARY DIARY DIARY
R: 27 / I: 4
I experienced what it looks like to be free from racism when I traveled to Switzerland. I‘m black and I was in all kinds of parts in Switzerland, even the very rural ones. Everyone greeted me when I walked by on the street. Both children and the elderly. When I asked some middle aged guy for directions he invited me into his garden and gave me grapes from his grape tree he seemed to be very proud of. I‘m not saying Switzerland doesn‘t have any racism. It probably does, but that‘s probably the closest to the real deal I‘ve ever had. It seemed like being black was a complete non-factor. It‘s unlike other Western countries where racism manifests socially in various ways but it‘s covered up with the typical slogans and denial.
R: 6 / I: 10

lesbian porn

porn of the women fucking each other variety
t4t stuff encouraged as well, but im starting off with some good ol cisles stuff
i'll try to post as much as i can but tbh im a bit picky so theres not a lot
R: 35 / I: 16
Stalinbros, you have to admit. Trotsky has those hype moments and aura. I fuck with Civil War Trotsky heavily. And having an iron train with the red flag. And the leather outfits. Can we admit, it's cool
R: 17 / I: 7
>You are a Luxemburgish nationalist






The body was too short or empty.The body was too short or empty.The body was too short or empty.The body was too short or empty.The body was too short or empty.
R: 2 / I: 1
He was the only proper socialist, all the others were crypto-liberals or crypto-reactionaries, which is why he made people like Stalin seethe.

Yugoslavia was also the most prosperous socialist state thanks to him.
R: 17 / I: 0

ॐ 卐 ✡︎

यदा यदा हि धर्मस्य ग्लानिर्भवति भारत ।
अभ्युत्थानमधर्मस्य तदात्मानं सृजाम्यहम् ॥४-७॥

परित्राणाय साधूनां विनाशाय च दुष्कृताम् ।
धर्मसंस्थापनार्थाय सम्भवामि युगे युगे ॥४-८॥
————————————————-
Yada yada hi dharmasya glanirbhavati bharata
Abhythanamadharmasya tadatmanam srijamyaham

Paritranaya sadhunang vinashay cha dushkritam
Dharmasangsthapanarthay sambhavami yuge yuge
——————————————————–
Whenever there is decay of righteousness, O Bharata,
And there is exaltation of unrighteousness, then I Myself come forth ;

For the protection of the good, for the destruction of evil-doers,
For the sake of firmly establishing righteousness, I am born from age to age.
R: 2 / I: 0
A true SPANIARD doesn't just fuck women. The true Spaniard FVCKS everyhitng and anything, as he is SPANISH TRVE VVILL is that of CONQVEST. the true SPANIRD FVCKS and CONQVERS women, ignoring if such women are fat, thin, tall, traditional, tomboys, hunks…; the true SPANIARD FVCKS and CONQVERS men, ignoring if such men are twinks, femboys or bears. The TRUE SPANISH SPANIARD doesn't get FVCKED, he's the one who FVCKS. That's the reason why the real SPAIN, was republican SPAIN, because republican SPAIN FVKED anything and everything, meanwhile cringe ass nationalist shit let others do the fucking.

Caesar once said: I came, I saw, I conquered. What Spaniards say is: I came, I Came, I came.

VIVA ESPÑAÑA COÑO.
R: 18 / I: 1
YouTube Poops must probably be the most mainstream piece of ""leftcom"" influence on culture (via situationism/letterism).​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​
R: 5 / I: 0
Bruh im an idiot, just realized the crips from 90s los Angeles actually mean. "Community Revolutionary Inter-Party Service" (CRIPS) and not just some ghetto slang for shooting as i thought back playing gta.
Why did a 90s gang that was apparently made since the 60s call themselves Revolutionary if they are drug pushers and gangbangers? Are they twisted Marxists or what? No im not from America how can you tell
R: 2 / I: 0
The backstory of "I have no Mouth and I Must Scream" is that WW3 had broken out between USA, China, and "Russia" (the original story was written during the Cold War, so the Soviet Union is obviously assumed there), and all three sides had used superintelligent AI systems to operate their weapons&resources, then one of the AI agents had gained [some form of] sentience, hacked&consumed other two AIs, and then immediatedly had turned on its creators and started the extermination of humanity. The story never specifies which side's AI agent it was, BUT…

The video game adaptation, which was written and produced by the orignal story's writer and had him voice acting as AM and thus is pretty much the official and canonical expansion of the story, explicitly identifies AM as an USAmerican AI. What is MUCH more interesting is that in the game, human survivors discover Chinese and Russian AIs imprisoned inside AM's electronic brain and need to free them and secure their cooperation in order to get the good ending, and these two AIs are much nicer and human-friendly than their USAmerican counterpart, even though they still have alien morals and are not really "good".

Hmm, was Harlan Ellison a crypto-communist, anyone knows?
R: 15 / I: 6

Grace-chan DESTROYS leftists

Stay tuned for a compilation of Grace absolutely pwning leftists.
too short too short too short too short too short too short too short too short too short too short too short too short too short too short
R: 42 / I: 5 (sage)
Stormfront is now complaining about Indians stealing white women. What is your opinion about Stormfront complaining about Indians stealing white women, write your opinions. Like and subscribe for more content.
R: 3 / I: 1
>zionist: [one of the various counties Israel is invading / genociding] would kill you for being queer
>looks at Israel
>Israelis kill queer people / suspected queer people on sight.

I couldn't find the article the screenshot is from sorry, several that breifly mention the incident but not this one
R: 27 / I: 7
Did Adolf Hitler have to overcome social anxiety?



post body too short or empty post body too short or empty post body too short or empty post body too short or empty post body too short or empty
R: 23 / I: 26
I miss the muscle women thread.
R: 25 / I: 16

Drug Inspirations/Million Dollar Ideas

I love getting stoned because it gives me awesome ideas.

Check this one out: a "weed bomb". You create a device which using some kind of extreme direct heat (but contained, possibly in a metal sphere like a grenade, but with vent holes) which combusts like a quarter ounce of hash concentrate in under a minute.
It'd be a party trick/prank or something. You'd set the timer, roll it into the room on the floor like a skee ball, and shut the door. The thing would blink lights and beepboop maybe and then just start spraying pure THC smoke into the air, perhaps rolling around on its own power like a firework or something, or a fucking Batman gadget! Yeah. It'd be an instant hotbox. You could do it in a car too, though it might be too much. Hey, different sizes maybe.

Well, it'll probably never happen because it'd be considered "assault" or "poisoning without consent" or something, so I'm giving my million dollar idea away, but it's a fun fantasy.

What do you think? Would that be a neat product?
R: 10 / I: 1
Where do you find a Nadezhda Krupskaya gf kameraden?

charlimit charlimit charlimit charlimit charlimit charlimit charlimit charlimit charlimit charlimit
R: 15 / I: 1
catholic guilt is preferable to protestant narcissism
R: 3 / I: 0
Nazism rejected the Marxist concept of class conflict, and it praised both German capitalists and German workers as essential to the Volksgemeinschaft. In the Volksgemeinschaft, social classes would continue to exist, but there would be no class conflict between them.[214] Hitler said that "the capitalists have worked their way to the top through their capacity, and as the basis of this selection, which again only proves their higher race, they have a right to lead."[215] German business leaders co-operated with the Nazis during their rise to power and received substantial benefits from the Nazi state after it was established, including high profits and state-sanctioned monopolies and cartels.[216] Large celebrations and symbolism were used extensively to encourage those engaged in physical labour on behalf of Germany, with leading National Socialists often praising the "honour of labour", which fostered a sense of community (Gemeinschaft) for the German people and promoted solidarity towards the Nazi cause.[217] To win workers away from Marxism, Nazi propaganda sometimes presented its expansionist foreign policy goals as a "class struggle between nations."[215] Bonfires were made of school children's differently coloured caps as symbolic of the unity of different social classes.[218]

wtf nazis were capitalists fox news lied to me
R: 20 / I: 5
Your appearance
>Nooo this is not real socialism.
>Th-this isn't real socialism either!
>Neither is that!
>Or this!
>Heh nice try capitalist scum but my hypocrisy knows no bounds..
R: 8 / I: 0
me and who?

The balls were too short or empty. The balls were too short or empty. The balls were too short or empty. The balls were too short or empty.
R: 18 / I: 3
how to stop being cucked, mogged and utterly humiliated by stronger more dominant alphas? im tired of being a beta faggy boy…. please have mercy on me alphaGODS
R: 39 / I: 2
Another hard pill to swallow. The sheer volume of leftist writing and theory is not a sign of their intellectual prowess but rather a symptom of impotence that an intelligent person copes with by engaging in more theorizing, which gives such a person (who are numerous among leftiists) a feeling of control when they have little to no control. The truth is that all the necessary theorizing has thus far been done, the solution is crude and simple but due to the state and circumstances of leftists today barely realizable. This fact doesn't change through more theorizing but it gives you the feeling that you are doing something productive when you are actually just walking in circles.
R: 150 / I: 198

ONLY FOR REAL MEN

only real men can appreciate such perfection
R: 28 / I: 11
what is ur weirdest fetish?!?!?!?!??!???!!?!?!?!?!?!?
mine are orgasm denial and orgasm shaming, which i've had ever since i was a wee lad, and i have no idea what caused it

flood detected in my ass
R: 1 / I: 0
I know i love to make "the joke is seggs" shit here but can i be honest here for a second
I can't play horror games unless its pornified because i'm too scared to deal with these kinda shit
Like my only knowledge of FNAF is from playing a porn parody called Five Nights at Fuzzboobs
R: 24 / I: 4

Civil Reminder.

there is no such thing as porn addiction, nothing is stopping you from not watching porn, nobody is forcing you to look at porn. if you don't like it, just turn around and walk away. if you do not want to watch porn, then don't. its not that hard to understand. you aren't going to get withdrawls if you stop watching porn cold turkey, you cant overdose on porn and die. porn addiction literally does not exist.
R: 4 / I: 1
my fellow unemployeds, shall we engage in the classic unemployment activity of watching cable television dramas from noontime until the sun sets behind the orchards?
R: 9 / I: 3

DSFARGEG

DSFARGEGDSFARGEGDSFARGEGDSFARGEGDSFARGEGDSFARGEGDSFARGEGDSFARGEGDSFARGEGDSFARGEGDSFARGEGDSFARGEGDSFARGEGDSFARGEGDSFARGEGDSFARGEGDSFARGEGDSFARGEGDSFARGEGDSFARGEGDSFARGEGDSFARGEGDSFARGEGDSFARGEGDSFARGEGDSFARGEG
R: 11 / I: 2

creepy houses (inhabited)

share your country's perspective of what constitutes a "creepy" home: tell your country, whom's house was it, and what made it unnerving\ creepy\eerie.
>also what type of jobs lets you interact with stuff like this on the dialy? crime scene\ deceased people clean-up crew? dealing with hoarder cases, schizo's houses, etc….
R: 316 / I: 252

Youtube Clickbait Thumbnails 2

i miss the old thread. it got nuked with the outage
R: 20 / I: 6
ZOHRAMOUCHE ZOHRAMOUCHE CAN YOU DO THE MAMDANGO
>the body was too short or some shit
>the body was too short or some shit
>the body was too short or some shit
>the body was too short or some shit
R: 6 / I: 0
how would you fight them? if you were walking down the outback and an angry pack of roidraged kangas looking for a fight or an easy mug jumped you. what would you do?
R: 11 / I: 1
"Tech people’s most incredible achievement in the last decade (besides making Windows even worse) is that they have made even the most hated finance guys seem tasteful and self-aware by comparison. At least they knew they weren’t doing anyone a fucking favor by clocking in." - Felix Biederman
R: 5 / I: 0
Still in a believer that /siberia/ should be the last clickable thing on the hot bar. It needs to be the most remote location on this board/. It is in the name!
R: 11 / I: 2

Zucchini thread?

Anybody remembers Ratatouille and its deeply anti-humanist Marxist (Althusserian) interpretation of the revolutionary art of cooking? So what if you get some fleas and the bubonic plague with your lasaga? You will eat ze food and like it.

My rat uygha Remi was like
>gonna cook that snob food critic peasant food

Was the rat secrete-ly a Maoist?

The body was too rat or too puppeted human
R: 2 / I: 0
The Dr. Oz anime arc was hilarious, I can't believe I used to watch this clowns show every day after school and believed he genuinely knew what he was talking about
R: 0 / I: 0
middle classers whenever they dislike one or another aspect of capitalism but are fine when it serves their needs: aaiiiiiieeeeee Bismarck, Fichte, von Vollmar and Hindenburg come save meeeeeeeee!!!!!!!
R: 68 / I: 21
if you came across a fox girl who was in oestrus and begged you to give her relief from her sexual frustration and and oblige her until she was fully satiated and tired from all the activity, would you do it why/why not?????
R: 18 / I: 1
I'm fine with hetslop. If one cares more about the gender of the pair than the chemistry and dynamic itself then it's probably not a very good ship.​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​
R: 9 / I: 2
Well, I don't comment very aggressively on the topic but I do think widespread porn is misaligned with my goals and a net loss for sexual liberation. I think porn upholds heteronormativity, it's the primary reason why 'straight' men have not broken through the barrier of homophobia to claim bisexual identification over the past few decades in the same way women have. Something close to one third of young women identify as bisexual now, whereas it was around 5% in the year 2000. Meanwhile, the rate of bisexual identification in men has gone from like, 1.5% to 2.5%. Porn is the reason for that disparity. As soon as homophobia lessened widespread digital pornography gained traction.

We've inherited a whole cultural mythology of circle jerks and homoerotic frat hazing rituals and none of that happens anymore really. it used to! Militaries, boarding schools, logging camps, fraternities, YMCA hostels, sailors, monasteries, and cowboys all had reputations as hotbeds of homosexuality for a reason.

C.S. Lewis wrote about his all-boys boarding school and the rampant normative homosexuality there in his autobiography:

<A Tart is a pretty and effeminate-looking small boy who acts as a catamite to one or more of his seniors. […] They were not like slaves, for their favors were (nearly always) solicited, not compelled. Nor were they exactly like prostitutes, for the liaison often had some permanence and, far from being merely sensual, was highly sentimentalized. […] You will have missed the atmosphere of our House unless you picture the whole place from week's end to week's end buzzing, tittering, hinting, whispering about this subject. After games, gallantry was the principal topic of polite conversation; who had a case with whom, whose star was in the ascendant, who had whose photo, who and when and how often and what night and where…. I suppose it might be called the Greek Tradition.


Cuban poet Reinaldo Arenas wrote in his own memoirs, Before Night Falls, about his own peaseant childhood growing up in rural, mud-hut, pre-electricity 1940s Cuba:

<In the country, I think, it is a rare man who has not had sexual relations with another man. Physical desire overpowers whatever feelings of machismo our fathers take upon themselves to instill in us.


Young men who didn't have sexual access to women would become increasingly sexually frustrated and then they'd end up experimenting with the homies at some point, alcohol often being an enabler when there were not normative (if secret) cultural forms to resort to. What happens nowadays? If you feel horny, you go in a room, shut the door, and be with the naked sexy women getting penetrated on your phone you have access to 24/7.

You know where that doesn't happen though? Prisons. Being prison gay is still a thing. Why is being prison gay still a thing? Mostly because you don't have access to naked sexy women in your pocket 24/7.

Porn stops the buildup of sexual frustration leading to prosocial behaviors that would result in men shattering the mythology of normative heterosexuality in a similar way to how women are currently doing the same. Regular pornography use is generally an anti-social, solitary activity. It halts the seeking of pro-social releases to sexual frustration and all of the emotional bonds that can help build.

The inability of low-status men to break through the barrier of heteronormativity has also played a factor in the blowback against feminism and the incel trend. There'd be a whole lot less of that if porn weren't satisfying sexual frustration in the most junk-food kind of unsatisfying way and men realized they could just go down to the park bathroom glory hole and get a blowjob, and if they couldn't get women to like them they actually could just kiss their homies in a romantic way.
R: 221 / I: 15
I'm autistic myself and I relate so much to this meme. I hate being around other autists, I feel so much second hand embarrassment and cringe because my parents resented me for not being normal. I've tried socializing with other autists but I just can't.
R: 2 / I: 0
What is your response leftypol? Do you agree with the video? Do you dissaggree? Was there something that should be added? Do you have any thoughts about it? Is this enough words to get through the fucking word limit barrier?
R: 12 / I: 2
What does leftypol think about pic related? Can this framework of whiteness exist alongside a Marxist or Marxian praxis?

If we say class should be considered does that mean it needs woven into this frame or that we consider it as a separate frame?

Would it be problematic to apply this to scale to other dominant 'races', for example to Brahmans within the caste system?
R: 7 / I: 1
Does your family know you're a leftist? My parents are very right wing and even though they would accept if I told them I'm a socialist, they would keep saying stuff like muh 100 million death, no iphone and shit so I just don't tell them.
R: 2 / I: 1
Did something happen recently that would make cockroaches harder to kill? These things used to pop like a zit if you accidentally stepped on them, but now you can slam the door on them 4 times, spear them with broom bristles 5 times and they'll still scurry off like nothing happened.
R: 0 / I: 0
Jannies deleted the White music appreciation thread right when I was about to post.

This was the last golden era of Whiteness. If you weren't there you have no idea.
R: 0 / I: 0
how much would you pay our gracious job creators for the privilege of being employed? would taking a loan for an internship a step too far in your public display of porky affection?
R: 401 / I: 246
you WILL post a video OR MORE!!!!!!!
R: 48 / I: 3

Leak the Druze cult, translate it into English, exterminate the reactionary peoples

Their texts (Kitab al-Hikma) are already available online in arabic - translate them into english, exterminate the al-Uqqal and make them spew all of their "secrets", cheer on any islamists that can get their hands on these vermin, liberate the al-Juhhal.
Destroy the feudal cult of lies. Translate their "holy" scripture, expose the Uqqal vermin already. Having a religion (feudal beliefs) tied to an ethnicity as part of its identity spreads feudal doctrine to its peoples by family association.
R: 4 / I: 1

female friends

the other day my sister told me it was weird I didn't have any female friends, I laughed it off telling her there are no women in my field which is true btw, stem in a third world country = sausage fest from industrial high-school to retirement
but I'm at work right now and I was looking at my friends and coworkers and thinking that none of them have friends of the opposite sex. some are married and have kids but their social circle is otherwise 100% guys. my father never had a female friend, nor did neither of my grandfathers or great-grandfathers (half of them rural workers, the other half different types of contractors and industrial workers)

so where did the social expectation come from?
R: 15 / I: 4
How can I gain weight? I've always been a skinny twink, and now that I think about it, how come will I fight for the working class if I'm weak? I go to the gym regularly and I have no problems lifting weights, but I fucking hate bulking, I feel full with so little food, I have to force feed myself.

I can bench 110lbs for like 5 reps, and I've been stuck for months. Also please recommend leftist music like war songs
R: 21 / I: 2
I just watched a porn video where a girl deepthroated a dick so hard that she shit herself

they tried to hide it with a jump cut but we all saw body too short or empty
R: 2 / I: 0

You know what? I like you.

Please accept this gift as a show of my appreciation.
Don't worry it's whole some fun times with a fish
I am suffering from severe alcoholism and have become a r34 and immersive sim connoisseur right after emptying my balls into all the boomer shooters
As I got depressed multiple times I could tell my life is never going anywhere but at least the body is no longer short nor empty
R: 19 / I: 2

horny asmr

does anyone have some recommendations for horny asmr? or any asmr content, post it in this thread ples.

i like listening to to it while i read this board
R: 22 / I: 4
People always ask what the meaning of life is, but if you could choose what the meaning of life is what would you pick?

Please remove the character minimum from the shitposting board. You‘re not even enforcing it.
R: 102 / I: 84
can we have a comfy nostalgia thread? 2000s and 2010s, 90s and 80s whatever makes you feel old

me personally? i'm posting a song from when weebs were edge
R: 189 / I: 195

hot trans women

a thread to post hot trans women
R: 12 / I: 0 (sage)
Is autism genuine or is just an excuse for people to have poor manners? Should autism be cured? Is applied behavioral therapy a genuine cure? Are autistic children basically just incels in training? You decide! This thread.
R: 2 / I: 0
wtf was marx doing in 1944 💔💔💔😭😭



The body was too fascist or national socialist. The body was too fascist or national socialist. The body was too fascist or national socialist. The body was too fascist or national socialist. The body was too fascist or national socialist.
R: 220 / I: 80
What would you do if you were a deliveryperson and you see Dasha opening the door like this?
R: 16 / I: 2
wait, you leftists polers have a fucking shop? i already said having a twitter and tiktok for a left-wing imageboard is ironic and you might as well start making a linkedin at this point…i stand correct.
this feels like when /k/ showed how anti-establishment and dangerous they are by posting anime and republican NATO ads on their board.

29 bucks? if they aren't fitted with kevlar or the spirit of marx and gramsci haven't ejaculated ectoplasm on the fabric, if the president of china haven't left a secret message in the shirt's pricetag with goog luck wishes and quotations i'm not intrested
R: 7 / I: 1
What do you guys do to fall asleep? And what do you do when you have a headache?
H
E
A
D
A
C
H
E
The body was short, or something, okay? Deek
Ludique
R: 124 / I: 40
>hurrr im gonna draw shit men do except with a woman doing it instead

why are gooners so retarded





this sould definitely be enough characters on its own but whatever
R: 10 / I: 0
Women shouldn't be allowed to vote because women are beautiful and perfect human beings who do not deserve to be duped into believing that the circus that is bourgeois electoralism can truly effect change.
R: 1 / I: 0
>SO LONG GAY ZIO!
what are the implications of the average joe identifying with anti-zionist messages even in big production super hero slop movies?
body was too short and empty
R: 18 / I: 6
Thoughts on Maya Morena, sex worker, petite Breadtuber, was or is DSA member, and porn star, though she seems to have retired from that (IAFD says 2017-2020)?

Maya Morena filler filler Maya Morena Maya Morena filler filler
Maya Morena Maya Morena filler filler Maya Morena Maya Morena filler filler
Maya Morena Maya Morena Maya Morena filler filler
Maya Morena Maya Morena Maya Morena Maya Morena Maya Morena filler filler
R: 8 / I: 0

very important question

Who was your favourite from Totally Spies?
R: 23 / I: 3
How do I overcome my irrational hatred for Artificial Intelligence?
R: 2 / I: 2
Pull my dick and I go far

The body was too short or empty.The body was too short or empty.The body was too short or empty.The body was too short or empty.The body was too short or empty.
R: 1 / I: 0

How 2 misbehave

<Step one
>Permablitz, especially when illegal; Teach yourself and others how.


<Step two

>Go extremely slow in the middle of the city or interstate to densify traffic

<Step three

>Regularly build an immunity to external reward and punishment (IE Lucid dreaming, Lakota Sun dance, meditation)

<Step four

>Continue to do research to despook as many people as possible.

>For example, behavior doesn't exist, and I mean that in the sense that there's no direct, much less, predictable connection to an organism's activities and stimuli, as evident by the fact that observational learning is unequivicably more effective than conditioning, even in elementry tasks, which require little to no language.


Rogoff B, Aceves-Azuara I. Mother-child collaboration in an Indigenous community: Changing and enduring across generations. Child Dev. 2024 Nov-Dec;95(6):1858-1878. doi: 10.1111/cdev.14181. Epub 2024 Nov 14. PMID: 39540594; PMCID: PMC11579644.
Fiorito G, Chichery R. Lesions of the vertical lobe impair visual discrimination learning by observation in Octopus vulgaris. Neurosci Lett. 1995 Jun 9;192(2):117-20. doi: 10.1016/0304-3940(95)11631-6. PMID: 7675317.

<Further reading


>approx. 1/30th of an acre is needed per person

https://web.archive.org/web/20200809210959/https://www.startafoodforest.com/how-much-land-do-you-need-to-live-off-your-food-forest/

>approx. 10 hours of work per person

https://abundantpermaculture.com/10-steps-growing-food-less-10-hours-week/

>predominately monocultural agriculture constitutes 10 percent of emissions

https://www.ers.usda.gov/data-products/charts-of-note/chart-detail?chartId=108623

>potato yields enough calories to feed more than 15 people per acre

https://www.waldeneffect.org/blog/Calories_per_acre_for_various_foods/

>Some corn and rice are likewise

J. Poore, T. Nemecek , Reducing food’s environmental impacts through producers and consumers. Science 360,987-992(2018). DOI:10.1126/science.aaq0216

Any questions?
R: 424 / I: 228

Burgerpunk Thread 1: Rebooted Winter Soldier

Restarting the Burgerpunk thread.
R: 30 / I: 3
>tfw no billionaire leftist asian ruler to hire YOU as a slave to beat up black and blue\ leave full of scars and bruises from whipping and caning
I haven't fapped nor watch p** in 3 weeks, im horny.
R: 0 / I: 0
Reject skibiddi toilet

Return to BRRRRRR SKIBIDDI DOP DOP DOP DOP YES! YES! YES! SKIP SKIBIDDI DIP SKIBIDDIDUBLYADUVLYADUVLYA YES! YES!
BRRRRRR SKIBIDDI DOP DOP DOP DOP YES! YES! YES! SKIP SKIBIDDI DIP SKIBIDDIDUBLYADUVLYADUVLYA YES! YES!
R: 6 / I: 4
DAILY REMINDER THAT:
1 - it's gonna be okay!!!!!!! 💖
2 - u can do it!!!!!!!!! 💖
3 - if u can't do it this time, there's always next time!!!!!!! 💖
4 - don't be so hard on urself!!!!!!!!! 💖 hehehehehe "hard on" hehehehe

drop a "very cool" down below if you approve of this reminder
drop a "very uncool" down below to disapprove of this reminder
R: 24 / I: 2
what do you OFFICIALLY think about:
gen alpha
zoomers
millennials
boomers

BE HONEST!!!
R: 11 / I: 4
vgh…superior french civilsation inventions. beyond my mere thirdie understanding…zee urinals publique…le pissoirs de l'occident

le piss was trés court et empty..
R: 5 / I: 3
New Multitude is dead. New Multitude remains dead. And we have killed it. How shall we comfort ourselves, the murderers of all murderers? What was holiest and mightiest of all that the world has yet owned has bled to death under our knives: who will wipe this blood off us? What water is there for us to clean ourselves? What festivals of atonement, what sacred games shall we have to invent? Is not the greatness of this deed too great for us? Must we ourselves not become gods simply to appear worthy of it?
R: 52 / I: 3
Who is the most based breadtumor? Or at least the least bad… if there are any

Are there any good ones? I like the deprogram guys but idk if they’re “breadtube”
R: 0 / I: 0

Conversation with a hairdresser’s assistant - Wilhelm Reich (1935)

Assistant: Style or a simple haircut?

Customer: A haircut please but square not round.

(Pause)

Assistant: What do you think of present times?

Customer: Terrible. Where will it lead to?

Assistant: The hooligans are going to cut each other’s throats and we'll get the worst of it whoever wins, whether the Communists or the Nazis. They're as bad as each other.

Customer: Perhaps you're right. I can't understand politics.

Assistant: I'm glad I've got a job and am making ends meet. As for the rest, all I want is to live in peace.

Customer: May I ask how much you in fact earn?

Assistant: 100 marks a month.

Customer: Can you live on that?

Assistant: Just about. I'd like to get married but it'll take a long time until my fiancée and me have saved up enough to be able to rent a flat. I've been working ten years in this place and I've not saved up enough yet.

Customer: What's your boss like?

Assistant: He's a very nice person. Sometimes he's a bit moody, but I get on fairly well with him.

Customer: How many customers do you deal with a day?

Assistant: 10 to 15. On Saturdays it’s more.

Customer: So that means that 15 customers pay 15 marks into the business. OK, but you only get 3.50 marks a day. What happens to the rest?

Assistant: You've not taken into account the expenses of our business. Lighting, telephone, insurance, instruments, rent, they eat up quite a bit.

Customer: I'd be interested how much.

Assistant: (thinks awhile) Well I suppose at least 8 marks.

Customer: OK, but that still leaves about 9-10 marks.

Assistant: Yes, but the business must make a surplus since the boss takes a great risk. For example, on some days there are fewer customers, or in bad times.

Customer: Does that mean that you get more when business is booming?

Assistant: No, why should I? I'm on a regular income.

Customer: I don't understand. When you work more you don't get paid more? And of the amount you earn on average for the boss keeps a fund for bad times?

Assistant: You're quite right.

Customer: If I understand you correctly, you produce after subtracting all costs about 10 to 12 marks for him per day and of this you receive 3 to 3.50 marks. And if times become permanently bad for the business he'll sack you, in which case the reserve fund is of no use to you. So what in fact does he use this money for?

Assistant: Well, for example the boss has to acquire modern machines. At present we're replacing the hand clippers by electric ones.

Customer: What does that mean?

Assistant: (surprised) What, you don't understand that? It's quite simple. Now I can deal with 10 customers a day, afterwards I'll be able to deal with 20 because the cutting will be much faster.

Customer: And each one of these 20 will be paying 1 mark as before. And you, how much will you get then?

Assistant: (even more surprised) Naturally, I'll continue to get my 100 marks.

Customer: Excuse my being so inquisitive, I’m getting a bit lost and am rather amazed. With the new improved machines you'll be earning 20 marks for, him but you yourself will continue to receive only 3.50. That means the surplus has grown from 8 to about 13? Where does the money go?

Assistant: (scratches his head) Actually, you're right. That's a good question but, you know, I get so tired from working that I don't have much energy to think. I'm happy if I can rest and keep my job. You know next week 2 out of my 5 workmates are being made redundant and I have to ensure that I'm not sacked too.

Customer: It must be pretty bad to stand 10 hours a day in the shop – what about holidays?

Assistant: Oh yes. I get a fortnight every year, but the others also go on holiday and when they do I have to do more work. And now the boss is going away for 2 months.

Customer: Where does he get the money to stay away for so long?

Assistant: He has a villa in Dahlen.

Customer: Oh. How come?

Assistant: Well he's owned this business for 30 years now.

Customer: I see. Does he work?

Assistant: Oh no, only sometimes he helps out. But it's a successful business.

Customer: Listen. I don't understand anything about such things but it seems to me that his villa and his summer holidays are paid by the 8 or 13 marks which you earn for his "business surplus".

Assistant: Oh I don't think so. But perhaps you're right, it is odd. I’d like to talk to you sometime about this. You talk a lot of common sense.
R: 6 / I: 1
Whats he up to these days? just chilling in moscow?

Side note but i think the assad curse still permiates through things associated with him; every time i listen to "allah syria bashar" i run into a series of unlucky situations, usually mild, but still bad
R: 4 / I: 0
>vindicated xhemselves through a prototype of a digitally planned state
>magnificent architecture and weather
>stays quiet, doesn't try to attract attention in global geopolitics in afraid of mutts traveling there
>high technological advancement and capital density due to redistributing rural labor
Bazzed country for the time being or passing fad?
R: 1 / I: 0

Glamping Pods

Has anyone ever had sex/been raped in one of these things?
How would you rate the experience?

body too short or empty body too short or empty body too short or empty
R: 7 / I: 0

Help me deradicalize and become a leftist

I was a full blown fascist but deep down I was gay and repressed it until this really huge, tall, hung, bear moved in as my neighbour and I have sucked his dick twice and will go on a date with him this sunday
I am scared i will chicken out so please debunk all fascist talking points: holocaust revisionism racism homophobia etc
I am still procesing i am gay but it’s great I love men 10x more than any woman
R: 222 / I: 116
tell me your most unhinged historical larpy sex fetish. don't tell me you have none, all imageboard addicts and history lovers have a few. sharing the few larps i caught in my lifetime

a girl fantasizing about being a european queen owning a harem of male slaves eating her out

a guy fantasizing about being a roman soldier and fucking boudica, or letting her take out all her anger and frustration on him with severe rape

being enlaved by dacian female raiders

fucking roman girls in toga while disscussing philosophy

being an icelandic skinny guy and getting captured and sold into gay slavery in the ottoman harem

young stalin

young drugged out hitler

being a conquistador and fucking everything from aztec girls to japanese geishas, to moor pricesses
R: 22 / I: 4
Does anyone else feel happier with life since they got into leftism? As a teenager I used to be a conservative and was angry all the time, I didn't go outside, didn't want to meet people at highschool, but then it was like my frontal lobe developed and I became more empathetic. Now I feel hope for the future, I want to help people, I've been to protests and unionized
R: 1 / I: 1
the only thing that comes to my mind when i hear the word "rightoid" anymore would be either a globalist, a neoliberal, or a monarchist.

we currently live in a world where even those who advocate for reactionary, conservative or sectarian policymaking would still require a heavy structuring and reorganization of their economic systems to a more leftist framework in order for their wishes to ever tangibly prosper. this even goes for those even vaguely communitarian but still fervently anti-communist people who were too infatuated with idpol culture wars to acknowledge the universal inequalities caused by capitalism.
R: 5 / I: 0
I am white cis and straight male from a second world country.
What should I do?

emptempty.The The body was too short or empty.The body was too short or empty.The body was too short or empty.body was too short or empty.empty.empty.y…
R: 1 / I: 0
If there are an infinite number of natural numbers, and an infinite number of fractions in between any two natural numbers, and an infinite number of fractions in between any two of those fractions, and an infinite number of fractions in between any two of those fractions, and an infinite number of fractions in between any two of those fractions, and… then that must mean that there are not only infinite infinities, but an infinite number of those infinities. and an infinite number of those infinities. and an infinite number of those infinities. and an infinite number of those infinities. and… (infinitely times. and that infinitely times. and that infinitely times. and that infinitely times. and that infinitely times. and…) continues forever. and that continues forever. and that continues forever. and that continues forever. and that continues forever. and…(..)…
R: 16 / I: 2
I'm convinced describing people as "introverts" or "extroverts" is just a few steps removed from using zodiac signs to derive someone's personality.
THE BODY WAS TOO SHORT OR TOO EMPTY
R: 29 / I: 30
The regulation of female pubic hair is not merely an aesthetic preference, but an expression of capitalist commodification and patriarchal control. The love of pubic hair is an expression of proletarian culture—a rejection of capitalist infantilization and the forced sexualization of childlike bodies.
In primitive communities without private property, pubic hair was universal and unquestionable, and there was no ideological apparatus for its removal. Women existed in their natural state, without aesthetic coercion.
With the advent of private property, the ruling classes imposed an aesthetic discipline on women. Hair removal became a bourgeois practice associated with the nobility and subordination, while working-class women retained their natural state. Thus pubic hair became an object of class struggle.
Capitalism enforces cultural hegemony, creating an artificial sense of shame around pubic hair to sustain industries that profit from insecurity. The fetishization of hairlessness infantilizes women, reinforcing male dominance and perpetuating consumer society.
The proletarian revolution dismantles capitalist aesthetic norms, restoring bodily autonomy and rejecting the shame imposed on women. Under communism, pubic hair will no longer be an object of struggle, but a symbol of true freedom—free from control, commodification, and capitalist influence.
R: 30 / I: 2
bro if there's no food beyond slop, no proper gym training equipments and there's no roids, why do prisoners always look extremely jacked in pictures? does fucking femboy pussy rewires your muscles?
R: 20 / I: 4
remember the cultural war of like 2013-2018 ish of The Alt Right vs Breadtube/Lefttube ?
It has been a resounding success for the Alt Right. The Alt Right died out because they are effectively the mainstream Republican Party now. Meanwhile most of bread tube turned out to be mid liberals and 'not blue no matter who' morons who will absolutely perpetuate NATO terror and US imperialism.
American 'Left' would be smart to study the how and why of this phenomenon instead of just dismissing everything they disagree with as 'Russian bots', 'transphobes', 'incels' etc
R: 18 / I: 5
no way, they invented the crakerstani soap, now all one needs is blue iris in the eye and a blonde touppe on your dark hair and you can at last crakkkamax like that indoesian dutch politician
R: 9 / I: 1
Watch this video
Wholesome seal action
Holy smokes dis uygha got a big one
Got a glizzy in da bag 😎
Why is he doing this??
And what is he saying can somebody translate
Thank you /leftypol/ /siberia/ ✊🏿✊🏿✊🏿
R: 9 / I: 1

For a festive right-wing

Being young and libertarian is terrible for picking up women. This is the biggest challenge for young men who aren't left-leaning.

One of the biggest challenges for young men who aren't left-leaning isn't the lack of access to literature that their teachers boycott (which is true), nor the lack of jobs when they graduate because their schools boycott them (which is also true), but rather the lack of young female students who sympathize with the libertarian or right-wing (almost an insult) position.

The programs where you find young libertarians (economics, business, engineering, and the like) have very few women, and those that do have them aren't very interested in intellectual conversations and politics. The breeding ground for girls who enjoy intellectual conversations and politics are programs like psychology, literature, social sciences, education, and the like, all left-leaning.

And then the problem arises: when libertarians get together, there's a severe shortage of women, which is always a tragedy. And when a lot of men get together to have profound conversations without a woman around, everyone looks like Sheldon Cooper. Without women, everything gets boring at some point. How do you solve a serious problem like this?

I'll repeat, because I know highly philosophical questions are difficult to understand: the biggest challenge for a young libertarian student in Brazil is picking up women (at university and elsewhere), while being a libertarian. Of course, personal charm, friendliness, intelligence, money, and cultural repertoire are always important factors, but the left has one point in its favor that is indisputable: if you're left-wing, picking up a woman is the easiest thing in the world. What's the left's secret? It's being festive.

The other day, talking with a friend and colleague who is quite well-known (so I'll protect his privacy), we came to the conclusion that the right (libertarian, of course; I'm not talking about people who enjoy torture, okay?) desperately needs to find its festive face.

The festive left (which is almost all of it) reproduced itself because it had so many women at its disposal. Imagine conversations like: "My love, free yourself from the oppression of women's bodies!" Now, imagine you're in a social sciences office late at night, or in an apartment with no one around. Some cheap wine, maybe a joint? Some cool music, a big picture of Che (that fancy murderer) on the wall.

Or imagine you're saying to a pretty girl something like: "Capital starves children in Africa!" Even though she's a young woman hardened by the battle against the oppression of women (which is why she desperately tries to be ugly), your heart will overflow with tenderness.

Imagine the energy of a riot! Arms linked or not, but walking and singing. Imagine the escape, running away from the police together. Hearts beating together!

And of course, imagine you two at the college bar (skipping class, because those who attend class don't get women): lots of beer, lots of vows of revolt against social injustice, lots of quotes from Marx and Foucault.

Or, even more sophisticated: a documentary film festival in Cuba! My God, could there be a better paradise to meet girls who "own their bodies"?

Since the earliest prehistoric populations, it's been known that without alcohol and conversation (that's why we learned to speak, otherwise only girls would speak), humanity would have disappeared because more than half of the girls wouldn't want to have sex—especially when they discovered the pain of childbirth.

The channel for a festive right is: talk about freedom, human suffering, bodies, discuss documentaries, say that life has no meaning but that beauty exists, don't dress like Sheldon Cooper, travel to Iceland, and (for God's sake!) don't talk about economics. Girls shun economics, that "sad science," because it gets in the way of the joy of life.

Or pray for Brazil to become Venezuela and then the libertarian boys will pick up all the girls.

I know: they'll say I'm saying we discuss intellectual conversations just to get women, but, sorry, that's exactly what I'm saying, at least in part. I woke up today in a Darwinist vibe. Sorry.
R: 13 / I: 1
I wanna go back so badly, /leftypol/, I think I missed out on the more pivotal moments of human history specifically those in Yurop and America which I will never cherish nor understand fundamentally to the very core, but only read about in books and gain, sadly, a secondhand feeling to this. I've been cheated having been born in this era, gentlemen. Gentlemen.. It's over.
R: 37 / I: 3
How come I'm still incel if I'm 6'0"? I thought lookism was real?
R: 4 / I: 0
why can't I manifest a set\specific, given, lucid dream with loa? or..I CAN?
I can't give irl money to a prostitute because that's unfair towards my Male Brothers in extreme poverty in the world; beggars in Indian rural slums, cripple elderly in Laos shanty towns, white killers at the SHU in Arizona.
thus, I will use LDs, trough loa, as a testmamen of my solidarity for men not rich enough to afford a (femdom) prostitute.
R: 7 / I: 2
this was the first gemdom society… vgh we need to RETVRN


Body body body body body body body body body body body body body body body body body body
R: 34 / I: 4
Sam Altman is tweeting about how we shouldn’t keep the ceiling capped on wealth for too long after the fastest spike in the ultra-rich’s wealth in history and the cutting of healthcare benefits for 17 million

You don’t fucking hate these people enough
R: 24 / I: 3
Under communism everyone is going to drive a Truck, personal preferences would yield to collective efficiency, and citizens might be required to drive full-size trucks—not out of luxury, but necessity. These trucks, thanks to their versatile design, can serve multiple roles: transporting goods, commuting, and performing labor tasks, all in one vehicle. Producing just one standardized model would allow for massive economies of scale, reducing waste and simplifying maintenance infrastructure. While some individuals may resent the bulk or fuel consumption of such a vehicle, the broader societal benefit—streamlined production, resource conservation, and universal utility—would take precedence. In this vision, the discomfort of a few is outweighed by the collective gain, as uniformity ensures everyone has access to reliable, multi-purpose transportation suited for the needs of the state and the people.
R: 5 / I: 1
raceplay is only non-problematic and revolutionarypilled when the scenario is a third world maoist guerrilla dominating a white social-chauvinist red army officer
R: 34 / I: 7
these things feel genuinely satanic





body dbsjwkdkwdkwfiegkdkvqfkvqfkvqfkvkqrvkqfbkqf fk qdk qfk qfk qkfvkqfvkqf kqrk qfk qfk qkf kqf kqfk qfk qkf kqf k
R: 114 / I: 80
Are there room for ponies?
R: 1 / I: 0
Communism is the only thing keeping this monster from destroying china, seeing as it hates the colour red

Change my mind

body was too aaaaaaahhhhrrrrggggg aaaaaaahhhhhhhhhggggggg arrrrrhgggg guys help i’m being attacked by a monster arrrrrggggggggg
R: 19 / I: 6
If you are a white guy and sexless, what is stopping you from just getting on rednote and sliding into the DMs of Chinese babes? It‘s literally easy mode for you guys, and nowadays some of them have phat asses and twerk.
R: 15 / I: 4

critique picrel

critiqueuhhhh this picture please
critiqueuhhhh this picture please
critiqueuhhhh this picture please
critiqueuhhhh this picture please
critiqueuhhhh this picture please
critiqueuhhhh this picture pleasecritiqueuhhhh this picture please
critiqueuhhhh this picture please
critiqueuhhhh this picture please
critiqueuhhhh this picture pleasecritiqueuhhhh this picture please
R: 5 / I: 0

misgendered 21yo cis dude award

I just spent a week in Paris for vacations, and i've been misgendered just about like… at least once a day, at bare minimum.

I have mid-long hair, been tying them up in a low ponytail (rather short, actually looks kind of like bun due to the curve of it), for a few weeks, while also keeping bangs on the side so i dont look weird with all my hair pulled back.

I quite like it, its nice especially for summer, and convenient, hair gets less in your face.

But it's been quite awkward with all that misgendering thing happening, on one side I assume people just look at me on a whim and only realize when i start talking, which makes them visibly quite uncomfortable all of a sudden, and also, I sometimes feel like they do it out of politeness, thinking i'm trans, but i'm not, so then it makes me a bit uncomfortable.

On the other hand I like being in touch with my feminine side, and being androgynous makes me feel nice and pretty and also cool about things like how i havent hit the wall just yet.
R: 166 / I: 39
I'm predicting that we will see a large portion of "Gamergaters" turn to liberalism in the coming months. They have never had any significant political politics beyond "more sexy women in video games" and some vague notions of anti-censorship and libertarianism. Whatever relationship they may have had with mainstream and dissident rightist movements is coming to an end, as the only thing they built their movement on is going to be further censored and removed. I can see them turning into Agent Kochinski and hasan types. That said, a smaller portion will probably end up following a dissident rightist path like Sargon, whose apparently become a Socialist, even posted about how Lenin had some good Ideas
R: 2 / I: 0
Stalin/Trotsky bros….i just heard the news from Mexico City…
Is this the end of the ship 😭


The body was too short or empty
The body was too short or empty
The body was too short or empty
The body was too short or empty
R: 14 / I: 3
We need to talk about the namefag "glowing rapefiend" for a second. Why is a nonce allowed to be on this site? All he does is post grotesque degenerate porn everywhere.
R: 16 / I: 7
i have a soft spot for woman on woman love, post gooning material, post safe for work material, just show me girls acting aroused and not caring whatever
R: 13 / I: 6
heh. boomers and their boomgaze hentai

this is what your dad watched as a kid before calling your cartoon too degenerate and revealing
the body was too old and horny
R: 13 / I: 0
So, can we kick the idea in the bucket that music has any impact on human behavior at all? Besides geeking out on the dance floor of course. The 2000s had plenty of anti-Western imperialism and capitalist critical messaging and still it hasn‘t raised any consciousness in society for that matter.
>Ah, yes, that‘s because capitalism‘s sublime nature to subsume-
No, it‘s because most people don‘t actually care about the lyrics. That‘s the banal answer. Even when people actually took note of the lyrics it all boiled down to expressing edgy rebelliousness to them and not „Ah, I have now learned that the US prison system practically conducts slave labor and for that purpose is more interested in incarcerating more people than lessening crime in the long term. How dystopian! I better get to organizing and educating my fellow workers.“ It‘s not because capitalism is that smart but because people are that dumb.
R: 17 / I: 6
comrades in third-world nations, how do you get your internet access? A lot of you post on here and I thought the internet didn't really exist over there
R: 4 / I: 0
why are all high I.Q. mfs commies

I cannot cope with this anymore I have nooooticed too much
theres no way this is just a coincidence
how do I cope at this point
R: 2 / I: 1
wew, what a nice nerdy soviet era artist, this cinamon roll was born on the north russian sea and studied old slavic rus art, he likes drawing old school style fantasy paintings, i sure hope he never ends up drawing an image that will be immortalized in tiktok save europe hyperborean edi_ OH LOOK WHAT NOW YOU DONE I TOLD YOU ABOUT HYPERBOREA BRO, I TOLD YOU ABOUT AGARTHA YOU FILTHY COMMIE
R: 5 / I: 4
when the bossman recognizes your hardwork by giving you extra ten minutes of free pissing time for a full year and says "don't tell the others this will be our little secret"
R: 1 / I: 0
>centre-left socdem candidate
<voting is useless. us communists shouldn’t participate in bourgeois elections. social democracy is the moderate wing of fascism [even doe the social fascism doctrine was abandoned by the Comintern after 1933]
>right-wing populist candidate
<we need to VOOT for this guy because accelerationism or something. he speaks against the elites just like us [by “elites” they mean academics and minorities]. no, i’m totally not a rightoid shill.
R: 8 / I: 2
You like capitalism

Capitalism is good

The free market works

The free market benefits everyone, including the working class

Neo-liberalism is good

Wealth naturally trickles down

Communism failed

The ussr was a brutal dictatorship

United states intervention is necessary for global peace

China is bad and will collapse any day now
R: 17 / I: 3
the fucks happening to twitter man






b,ody odjdjeu ebehejejrjejejeudiodpw0qpq9qw9w9q9qq99w9dudhdhdhdhdhdhjsawwwwwwwŵa huuyyuuuyyytt566777aaaaaaa
R: 1 / I: 0
Would you vote for Ted Cruz, /leftypol/? Hmmmmmm?? Well?? Israel is clearly more important than the United States, how could you not support it you bigoted antisemites?
R: 22 / I: 1
New to leftism. Why are trotskyists a laughingstock? Is it trotsky himself or some later development from the followers of his ideology? I've seen this everywhere in the online left

I have not much more to add beyond the question
R: 4 / I: 1
4channers talk a big game as critics and consumers of art, but the vast majority of creative works that have come out of 4chan have been hot fucking garbage. Literally every popular /x/ creepypasta sucks.
R: 14 / I: 4
quick you have 5 seconds to convince THEM to join the intergalactic communist jihad. What are you uploadin(They are a giant computer god) to get them to join the cause??
R: 6 / I: 0
This is genuinely (no really) the best fight I’ve ever seen.
R: 76 / I: 88

AI Effortposting

To offset the influx of slop content in /siberia/, this thread is only for (relatively) high-effort AI content. Only post content that fits at least two out of the following three basic criteria (or preferably all of them):
>It had at least a MINIMAL amount of your own editing done to it through inpainting, outpainting, manually drawing, and so on. This could be anything from simply removing an unwanted artifact to completely redrawing a generated background in a character portrait.
>It uses a distinct style rather than the generic "slop-style" typical to both anime and realistic/semi-realistic images. This can come in the form of it being made in the style of a specific medium like pixel art or an oil painting, in the style of a specific era like 1980s anime, or it can even be in a style that imitates a specific artist. Whatever works for you.
>It's based on something that's at least partially an original idea rather than being yet another funni meme redraw.

Show me that /siberia/ can make something better than slop.
R: 18 / I: 0
I think I have an heterosexual "black power" fetish. Im a white man, im not even murrikan, but I have fantasies of african-american women humiliating me racially and enslaving me\ sexual-themed torture or just plainly torturing me.
IRL im not racist, but not "militantly" anti-racist either frankly. I feel proud of my race to a normal level, and don't like being humiliate or mistreated in general really. Am I going schizo?
R: 71 / I: 28

Netherchan

I made a dutch speaking image board because my life does not have enough problems and I'm too weak to smoke meth.
Http://www.netherchan.org
R: 5 / I: 1
MAGAbros.. what's going on? What happened? This is not good MAGAbros, not good at all. Just look at all of this stuff that Drumpf hasn't accomplished that he said he would. I guess he was just lying the whole time to get more power, huh?
R: 20 / I: 3
who do you think has the biggest cock?

cockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcockcock
R: 12 / I: 4
god damn dude, i spent like several hours trying to make the perfect elven slave ai chat bot for any sick twisted sex fantasy i could come up with, and once i actually started rping with it i realized i could just make her repeatedly and mercilessly tease me for having a small penis, so i ended up doing literally nothing but that for a whole day and i have never been more turned on wtd
R: 44 / I: 2
Incels are men with undiagnosed BPD. Not saying misogyny is a medical issue, but incels specifically are BPDs who are undiagnosed due to the shrink industry/institutions being misogynistic.
R: 9 / I: 3
I recently got arrested in Mexico City and had a few books on Stalin and Lenin with me.

The Mexican cop took out my books, and raised his eyebrows.

“Te gusta Stalin?” He asked.

“Si.” I said.

A huge grin came over his face.

“Yo tambien” He said.
R: 13 / I: 1
What do you do when you have no personality? No one cares about whatever interests and hobbies I get into or what I do. They will always see a bore at the core. You can only spend so much time pretending with another personality until they notice the cracks.
R: 3 / I: 0
Is there any difference between Juche and autarky? i mean, both argue the need for self reliance don't they?

explain in ten billion words or however many leftypol wants nowadays
R: 30 / I: 13
we used to goon to ts 💔
R: 2 / I: 0

Confession

Guys, i’ve gotta come clean about something: i don’t actually read anything thats written on this site, i only come here to look at the funny pictures
R: 4 / I: 1
look at this ai generated image of me, it looks real just like me irl lookk at it its almost like real lief, its so life like just like me fr fr size accurate too btw
R: 6 / I: 1
Support the Brazilian-British-Chinese (BBC) axis against the evil imperial powers of the US, Argentina, and Ireland (USAID)

god bless comrades. dont let them lie to U ok
R: 30 / I: 7

Left unity thread

In this thread, say something nice about your fellow leftist factions: mls say something nice about trotskyists, maoists say something nice about anarchists, etc

We all may differ in various ways and beliefs but our fundamental goals are the same, and we share a common enemy in the bourgeoisie - so why can’t we get along until they have been defeated?

And no insults disguised as compliments! Nice things only!
R: 0 / I: 0
you know 4chan has became mickey mouse because every single greentext that dorks repost onto other sites got reddit spacing now, some even just lazily edit an existing screenshot in paint or whatever it is that kids use these days to add their opinion in greentext format because they unironically believe that it was posted on The 4chan gives their opinion more weight lmao
R: 1 / I: 0
>Zukowski reckons that's just not the issue: "The reason Steam makes indies so much money compared to all the other platforms is that they have built up an audience that is full of super die-hard hobbyists… Basically, hobbyists buy stuff not because they actually want to consume it, but because they are collecting it."
>This is illustrated by the so-called "pile of shame" from various hobbies: great stacks of Lego sets waiting to be built; a room crammed with Warhammer model kits; the Everest-like mounds of yarn that knitters call their "stash." Apparently the Japanese even have a word for those who buy books and pile them up knowing they won't read them: "tsundoku."

treatlerism is a mental disease
R: 1 / I: 0
Siberia

** 起来,饥寒交迫的奴隶!
起来,全世界受苦的人!
满腔的热血已经沸腾,
要为真理而斗争!
旧世界打个落花流水,
奴隶们起来,起来!
不要说我们一无所有,
我们要做天下的主人!

[副歌:]
这是最后的斗争,
团结起来到明天,
英特纳雄耐尔
就一定要实现!(x2)

从来就没有什么救世主,
也不靠神仙皇帝!
要创造人类的幸福,
全靠我们自己!
我们要夺回劳动果实,
让思想冲破牢笼!
快把那炉火烧得通红,
趁热打铁才能成功!

[副歌]

是谁创造了**
R: 17 / I: 1
>tfw my dream of a national bolshevik cybercommunist neorenaissance techohumanist soviet russian society that with a joint-military campaign with china nationalized all resources and assets in africa and reinvested it into the country while establishing the Slavic Economic Union aka new warsaw pact with all the eastern countries which makes all western countries have recessions and have to open trade with us in order to survive which in turn makes us richer and in turn makes us reinvest the riches into education and science to produce 200 autism score slavic ubermensch that invent an anti-gravity engine which revolutionizes transit and domestic industry to which we start launching spaceships to form a lunar colony on the moon to extract more resources for trade and industrialization which makes us the global superpower and vanguard lord for the next millennia of humanity will never come true
its over
R: 32 / I: 3
Just a reminder to all that who you duck is inherently political. Eugenics permeates every aspect of capitalist society and dictates your romantic preferences. Not wanting to date someone because you fear your future children will inherit their autism or genetic illness is eugenics. Wanting to date and breed with colonizers is eugenics. Wanting to date “intelligent” people is eugenics because you’re indoctrinated to believe having “smart” children is superior. The most important thing we need to do is unlearn eugenicist thinking before we can have socialism.
R: 10 / I: 0
>ruZZians are now killing birds just for flying over the Ukraine border
How exactly is this going to achieve global socialism?

body too short or empty
R: 21 / I: 1
Just how fucked is the Russian Tsardom? Are we talking point of no return fucked? Does this end in balkanization or is Russia on path for something worse?
R: 40 / I: 4
What's it like to have friends?
R: 12 / I: 2

hygienemaxxing

ITT: we discuss the best ways to make ourselves so fresh and so clean clean
R: 7 / I: 1
Why are women like this? Immediately after her confession she redirects blame.
>it was my wife's fault not mine!!!! I was doing my best but she forced me
Like clockwork.
R: 14 / I: 2
Do you know much about the history of incest?

I have been studying the topic for quite a while, specifically looking at the history of incest within England and within literature, and came to the conclusion that the incest prohibition laws we see in modern England are a precipitaory downproduct of the victorian housing crisis, in which large destitute families would often be stuck under one roof, with family members often sharing beds, and due to the tradition of 'sisterwives' I.E., marrying your dead wife's sister, incest became somewhat of an epidemic – amongst the poor. I say amongst the poor because the rich were doing it flagrantly and without concern for some time. Incest was a common topic and romanticised in 1600s-1800s literature, in fact a cousin marriage was the 'happy end' of Jane Austen's Mansfield Park (good book btw).

But ofc, when the poors started doing it, it became 'disgusting and dirty'. I think it's kind of romantic though personally.
R: 17 / I: 1
How did gamergate kickstart the alt-right and lead to trump's election?





















The body was too short or empty.
The body was too short or empty.
OKThe body was too short or empty.
OKThe body was too short or empty.
OKThe body was too short or empty.
OKThe body was too short or empty.
OK
R: 6 / I: 2
Does anyone have the original comic? I can only find edits.

Booru post https://lefty.pictures/post/view/15857
damn when did they put this text limit on siberia of all boards?
R: 35 / I: 18
Guys, I realized that to reach young men, you need a podcast. Books? Videos? Nah, just make a podcast. All young men at some point make a podcast, so there is a spiritual calling between young men and podcasts. So, who wants to start a podcast with me.
R: 5 / I: 0
My brothers, my sisters. I come here today to bring you a message of solidarity, a call to action and a DEMAND for adherence to duty as members of the vanguard of a Proletarian resurgence and ultimately total Proletarian victory.


Out of the cities, out of the streets, poured the Proletarian hoard,
Their flag to April’s breeze unfurled,
Thence the Proletariat came,
And removed the Capitalist forever, forever from this world.


Out of all Proletarian communities, only leftypol has the potential to bring us to victory. Through leftypol lies the salvation for our entire class – we can not fail. On leftypol we have broken the chains of Capitalist thought. We know not the meaning of the word “mine,” it is “ours,” — our class, the totality of our people.

Ten hearts, one beat. One hundred hearts, one beat. Ten thousand hearts, one beat. We are born to fight and to die and to continue the flow – the flow of our people.

So comrades, duty calls. The future is now. If a month from now, you have not yet fully committed yourself to the Revolution and the responsibilities thereof, then you have, in effect, not only betrayed your class, you have betrayed yourself. So stand up like men! and drive the enemy into the sea.

Comrades arise! Look toward the stars and proclaim our destiny.

Defeat never. Victory forever!
R: 51 / I: 4
It's crazy that men are so god awful at practicing basic hygiene we've just accepted it's easier to snip them at birth than to expect that they spend a minute scrubbing under their dick while showering.
R: 7 / I: 0
Do you believe a protagonist must be likable for good story writing? Yes, no, and why?

Why is there a character minimum on a shitposting board. Yes, the body was too short or empty.
R: 1 / I: 0
À quel point la monarchie française est-elle en difficulté ? Sommes-nous en train de parler d'un point de non-retour ? Cela aboutira-t-il à une balkanisation ou la France est-elle sur la voie du pire ?
R: 12 / I: 3

I hate wrestling (no actual wrestlingh

Clinchwork, throws, submissions, whatever, time and time and again, wrestling has proven itself to be both exhausting compared to striking, less reliable, and less efficient—and I have proof. Wrestling is dangerous for any situation involving multiple opponents (so like nearly all street fights), it exposes the tackler to elbow strikes/knee strikes/dirty boxing, it’s far more exhausting to keep someone on the ground than ordinarily striking at them making it unviable for multi fights (you have to use more of your body weight in groundwork), god forbid you’re wrestling on pavement or really any hard surface, god forbid you’re wrestling on any surface with mud and dirt that can get into your face, it’s even worse than striking in environments with a lot of environmental clutter given how much it restricts your own movement and field of vision, *learning how to wrestle to begin with is also exceptionally harder and more expensive to train than striking and footwork*
, I could keep going.
There’s a reason why the best fighters in the mma scene are usually strikers and why exceptions like Islam and fraud jones aren’t the rule. Clinchwork just has too many problems and ultimately it’s used most often (horribly, most people including cops are awful at clinchwork and rely on evolutionary instincts to figure it out) by people unable to throw a kick or a pinch without tripping over themselves—so most people or at least weaker ones. All brawns and no brain.
R: 4 / I: 1
Does Xi speak English? I want him to whisper sweet nothings in my ear while falling asleep.

The body was too short or empty.
The body was too short or empty.
R: 86 / I: 15
If you think about it, it's really fucking weird that a large section of the American population sincerely believes that Native Americans follow 'indigenous pagan' religions, while the overwhelming majority identify as Christian IRL
R: 5 / I: 1
Comrade Jaiden released a new video
the lesson of this one: know your Asian women!
the body was too short the body was too short the body was too short the body was too short the body was too short
R: 18 / I: 5  

midi hardware and its socio-cultural consequences

Remember when back in the day you had to have a so-called audio card that would allow your PC to fukken produce sound?

Pepperridge Farm remembers.

Most interestingly, depending on what hardware you had (ADLIB, SoundBlaster, GRAVIS, etc.) you would recieve a completely different end-user experience.

Compare these two:
https://m.youtube.com/watch?v=dHechz7U0sE&pp=ygUWRGlzY3dvcmxkIHNvdW5kYmxhc3RlctIHCQn8AKO1ajebQw%3D%3D (from 38:10)
&
https://m.youtube.com/watch?v=jAHgpRitmHY&pp=ygUURGlzY3dvcmxkIG9zdCBzdHJlZXQ%3D

It is absolutely unique, to have to have 2-3 different (hardware) interpretations of composed (software) music.

I think there should be theoretical articles written about.the differing "gaming experiences" ppl had/recieved based on their fucking soundcards.

It is cery interesting (to me, at least( that 2 ppl could have played "the same game," yet their hardwares produced 2 different musics. In essence, we can't talk about a singular "gayme experience."
R: 8 / I: 1

Improvment

Not Self Improvement, since I realized something.

Most people suck at improving themselves. Especially young men, as we know the vanguard of the revolution. Too busy masturbating and playing videogames. Isn't it odd how they always need a strong father figure aka a daddy every few years, Trump, Peterson, Tate, BAP. These boys are driftless and easily influenced. That's why self improvement is not the answer Re-education is the key. Sending them to the countryside. Berating them, but not in the Democratic way. Democrats/Libs berated you with no plan on how to improve while Republicans/Conservatives just jerked you off saying how special you are. We need to berate them like army officers and give them discipline in their life. That's what many want to do but can't. Join the army and learn what it means to not be a lazy piece of shit. We need a left wing Kevin Samuels
>Who is Kevin Samuels
TLDR, he basically berated black woman to be better. More high value. I don't agree on the high value. But berating people. Now thats more like it.
>inb4 leave the youth alone
Maybe when they don't emulate Asmongold's nature should they be freed. Till then, a strict 5 year plan will be enacted and you will be forcefully be radicalized/improved.
R: 19 / I: 4
Anyone here going to trotfest 2025?
Also since this will be my first time in London, give me some recommendations for places to visit. Particularly nightlife, local clubs and bars that are not a tourist trap.
R: 4 / I: 0

LISTAN PROPARLY

Ini di beninging

Ini de

Ini… Beninging

Ini [LISTAN PROPARLY] de beninging

…ini

>The body was too ini or beninging

'accepted'

https://m.youtube.com/watch?v=tPsBztxt8oE&pp=ygUQQ3VtdG93biBuaWdlcmlhbg%3D%3D
R: 5 / I: 1
>Wild orcas across four continents have repeatedly floated fish and other prey to astonished swimmers and boaters, hinting that the ocean’s top predator likes to make friends. Researchers cataloged 34 such gifts over 20 years, noting the whales often lingered expectantly—and sometimes tried again—after humans declined their offerings, suggesting a curious, relationship-building motive.
Posadists must feel pretty good rn.
https://www.sciencedaily.com/releases/2025/07/250701020706.htm
R: 7 / I: 0

Imagine you receive a good inheritance

Imagine you receive a good inheritance.
As a leftist person, what would you do with the money in country?

Donate? Burn it?

is a doubt that I have for a long time
R: 15 / I: 1
>Null from KiwiFarms having tried to call CPS on a girl's parents so she would move in with him back in the day.
>Gap far too big even for Romeo and Juliet clauses to apply.
>Girl in question being legit underaged (15) while he was 19 at the time.
R: 0 / I: 0
>Metropolis (1927)
<any revolution not led by the middle class is fake. union rabble rousers must be rooted out so that all classes can build a glorious new empire together. and the world is controlled by Moloch worshiping "elites"
>morons whose idea of Fascism is Indiana Jones Nazis
<oh, I just can't figure out the politics of this movie
R: 17 / I: 2
sister and her kids came over for the weekend and all they do is play fucking roblox. All the money on a ps5 and xbox just so it can play something that runs on a microwave. But now I'm studying it to figure out what's the optimal game for making profit with the least amount of effort.
R: 5 / I: 4
I miss the gay porn thread

>body too short or empty

>body too short or empty
>body too short or empty
>body too short or empty
>body too short or empty
R: 23 / I: 6

What is the materialist explanation for the 1970s serial killer epidemic?

It's laid out in a new book.
Grauniad review: https://share.google/4v28K7StDU7L4abRg
<1920s doctors observe lead poisoning from paint makes children "crazy-like"
<Guggenheim dynasty builds its' fortune off mining and smelting metals
<sulphur dioxide, arsenic, and lead particle cloud emanates from smokestack of smelting facility in Ruston, outside Tacoma
<Ted Bundy grows up in Tacoma
<Gary Ridgeway the Green River Killer is from Tacoma
<Charles Manson is in the clink in Tacoma for five years before starting his race war cult The Family
<1974 murder rate in Tacoma goes up by 62%
R: 10 / I: 1

What's wrong with being reactionary?

What's wrong with being reactionary?
People here always complain about reactionary things and persons, but why? What is preventing someone from being a communist and a reactionary at the same time?
R: 9 / I: 4
name various things that go in the thought bubble and maybe I'll make a video montage of them when I have time

also suggest songs for said montage

the body was short and stacked
R: 13 / I: 1
Imagine you receive a good inheritance.
As a leftist person, what would you do with the money in country?

Donate? Burn it?

is a doubt that I have for a long time
R: 15 / I: 2
How can leftists not kill themselves in this world?
Asking for myself

>the pills were too few and empty

>the noose was too short and brittle
>the pills were too few and empty
>the noose was too short and brittle
R: 5 / I: 0

How to tell if someones liberal

If they say something along the lines of "The proletarian revolution will never happen.", they are a liberal. Or if they spout other succdem beliefs
R: 9 / I: 4
this is a PORN FREE zone!!!!!!
u can only post non-porn-related things, like the holy bible and the virgin mary and so forth!!!!!!!
R: 22 / I: 12
this is what i'm gonna do to all MAGA


if you disagree you want to sex MAGA. i don't sex MAGA i #fuck maga like it fucked the country
R: 4 / I: 0
Is there a minecraft launcher for windows 7 that actually works? exclude betacraft.





osdjvoifajv]dv iefvjo fpovjpeorfvjope fvokerpovj sfdpovjopvj wvopjropvj fpovjfpojv fdv opvj vfopjdopvj spovjj op
R: 44 / I: 8
How come far right 16 year olds are better at making propaganda to indoctrinate the youth than communists?
R: 9 / I: 0
>Only your wealth purely matters, not your genes or anything like that no no no let's not talk about that you racist!
>Of course populations are um different but it doesn't matter
>Racist
>*smug face*

This is why your opposition leaves because you aren't to be taken seriously, leftoids
R: 19 / I: 6
i for one, kinda like them, the food, the architecture.

on another hand however they seem irritated towards foreigners or just non-poles a lot, not even browns and thirdies like myself, other white passing people too like ukrainians and russians. that and gays and commies, unless they can use gays as a pretext to tell you why other countries suck, they hate them in general

anyone else has a love hate relationship with pooland? wanna love them, kinda sympathize for them getting assfucked in history and love the place..but they also seem like racey, reactionary dicks
R: 5 / I: 2
>mom…..dad….i'm….i've been keeping this away for so long but i have to tell you………………mom, dad…i think i'm straight i think i like girls
R: 2 / I: 0

Delulu, Solulu, and Trululu

>Delulu (/dəˈluːluː/ ⓘ) is an internet slang term used to describe the belief that one can influence one's own destiny through sheer willpower. Derived from the English-language word delusional, the term has its origins in K-pop communities where the term delulu is used to refer to individuals who were in a parasocial relationship with celebrities and had hopes of meeting them someday. The term has subsequently been adopted by Generation Z and Generation Alpha, popularized by viral TikTok trends such as the catchphrase "delulu is the solulu", implying that self-confidence is key to achieving one's dreams, however far-fetched. Solulu and trululu are slang terms for "solution" and "truth" respectively, and they are modeled after delulu.
https://en.wikipedia.org/wiki/Delulu
bruh, I feel like a boomerulu after knowledging myself about this

can anyone relate? please like, share, and subscribe! hit that button!
R: 5 / I: 0
>T, we're stuck in the middle of the fucking desert here, theyre writing on clay tablets or some shit, i think we're in ancient mesalophania, whatever the fuck its called. you gotta help us
<tell em about those arcadian sick fucks, tried to clip us, they dont even speak english im pretty sure
R: 14 / I: 0
glowies are getting desperate for that paper, now they employing animu gals

by the way how do leftists feel about paying taxes? good for the public needs or just a theft?
R: 19 / I: 2
what is the materialist explanation other than everything being more expensive for millennials not wanting to have kids? Are videogames and/or porn to blame
R: 24 / I: 3
o-our response communists?

pls ignore 3/4 of the image focus on the center what's our reply to argentinian bros doing lolbertarian capitalism and getting a W
R: 21 / I: 8
RETVRN TO PRIMCOM PSYCHEDELIC DOMMY-MOMMY SHAMANISM
R: 39 / I: 4 (sage)
no gf in 2015
>listen incel, women don't owe you sex, you creep. Stop trying to get a gf and learn to be happy being alone, okay sweaty???
no gf in 2025
>um, what the fuck? excuse me? is that…is that an AI gf? You're dating a chatbot? This is not fucking okay. You need therapy, now. You need to find a real human gf. Uninstall that chatbot right now, creep
I'm starting to think normies just want us unlovable surplus males to suffer and aren't really interested in "helping" us at all. You'd think they'd be happy for us that we found some harmless cope to entertain ourselves during our exile from the dating pool but nope, they seem to hate the idea of us being content in any form, even if it doesn't affect their lives in any way. Nothing we do will ever be good enough for them.
R: 22 / I: 5
>walking around with ur white gf could cause a chuddie to crash out and shoot up a random school
What kind of power is this… so much control over the life of a chuddie… just walking around minding your own business and a chuddie decides to end it all because of you. This power feels kinda good.
R: 18 / I: 6

new favicon

Some of you might have noticed that leftypol dot org's favicon, the little icon at the left end of the tab in your browser, has vanished. In this thread we propose replacements. Here's mine:
R: 4 / I: 0
reality never felt real to me. im so detached from everything, I could lose my job tomorrow and I would probably not even care..











nody sody fody lody pody rody kody
R: 7 / I: 1
>anon, my dude. like, i like hanging out at your crib and all, but i see to books by female authors in your library, like. aren't you all commie for women empowrment n shit? if im gonna spend time with ya i hope i can least hear you reading a book by a woman

how do you react?
R: 35 / I: 1
Why is Western Buddhism always hippie shit like loving kindness and mindfulness? But when you look at actual buddhism it's brutal? Like why are there no corporate guided meditations about impermanence and suffering and ceasing to be??
R: 0 / I: 0
gimmie all your JDPON unlimited edits


The general election 美利坚 Is approaching 要大选 From New York arises Donald Trump 纽约出了个川普唐 He strives for the voter’s happiness 他为选民谋幸福 You are fired He’s the great America great savior! 他是美帝大救星
R: 14 / I: 3

places to live?

what's the nicest place to live in England for a socialist? I've had some bad experiences with moving down South bc it seems very plastic and artificial, maybe since its the imperial core. I'd move to China or Brazil but you can't simply move to those places generally and I don't really want to put my doggy through quarantine. I was thinking of moving to a nice small affordable town with nature and whatnot.
R: 4 / I: 1
>it's 2045
>you open your Google-Apple device
>decide to browse DisneyTube
>find an obscure old video from the YouTube era
>it's a guy reviewing an ancient Batman movie
>guy tries to be comedic but is a bit hit or miss about it
>until
>BAT CREDIT CARD
<hah hilarious
R: 18 / I: 2
>realize have crush on friend
>6 year gap (21-27)
>she has a boyfriend

all i do is write in my baka diary about my feelings for her
i've moved on from crushes before and become platonic

but i'm tired of this, running away
i dream of meeting her in 10 years, she's single and i ask her out casually
R: 0 / I: 0
>interview white americans at random
>ask them various questions about politics, economics, culture, science, society, family, occupation, relationships, dreams
>take their answers and make an LLM create a speech based off those answers
>vid related
R: 31 / I: 9
The reason for the mommy nonsense is explicitly game theory applied to sexuality, sexuality as a social relation that's being rationally calculated by its actors. Sexual stimulation without any attached responsibility, as the entire phenomenon of "safe-horny" is.

From a game theory standpoint, one always wants to be submissive. Submissive sexuality is considered less threatening/more socially acceptable than dominant sexuality. If one can cast themselves as a victim, one can [plausibly] get off without being considered predatory for it. It's a means of hedging - "I need to get fucked" is considered softer and safer than "I need to fuck someone".

Likewise for "woke" fetishes - "where's the bush", those that can be plausibly hand waved as jokes, etc.
R: 15 / I: 3
I have nothing but contempt for most people. It feels like they have held my self-actualization hostage because they can't let go of their delusions, something which porkies readily exploit. I hate being limited by the human form itself, and because of not being in control of my time I can't even improve within its bounds. Fuck this existence. Fuck humanity. Fuck godcucks. Fuck classcucks. Fuck porkies.
R: 9 / I: 0
Does this happen in your country? I feel like this happens in many countries. I see it happen in many countries. This is not often discussed, but it should be.
R: 10 / I: 0
bro this is like the sadiq khan shit in 2016…one brown muslim politician in burgerstan going "p-pls a little extra taxerinos, zionism not very good" and now NYC is ruled by muhammad-stalin jew killer(cringe) 5.0
how did burgers vote for his succdem ass if they hate his guts this much and believe he deserves death for walking islamically?
R: 6 / I: 0
I'm a chud.

AMA /leftypol/

The body was too short or empty.
The body was too short or empty.
The body was too short or empty.
The body was too short or empty.
R: 13 / I: 2
sorry but i straight-up don't care that real socialism is about work or whatever
there is literally nothing i want to do in my life other than lie in bed and read.
R: 8 / I: 1
Whats up with liberals saying racism from brown people is extreme and then they drop examples that are like basic entry-level racism? Like, when did you ever meet a Black & white person and they were accepted as 100% white?

Flood Detected, Toilet Discharge
R: 19 / I: 4
I recently found out that 4chins word filters "graebener", the last name of a certain rock thrower.
I didn't expect them to guntguard for a fat latinx fascist.
R: 2 / I: 0
remember when everyone went full Covid vax-esque with this by saying that anyone who takes it will suffer from giga-aids cancer side-effects in two more weeks?
R: 5 / I: 0
Gierek won Deng won Market socialism won hardlinercucks lost geg
>but muh betraying the revolution
Deng and Gierek lifted milions out of poverty,very bourgie indeed

>but muh
R: 1 / I: 0
did celebrities (cosmonauts , athletes\olympics, musicians, etc) in the Non-revisionist Soviet countries, like Stalin era ussr, Hoxha's Albania, Belorussia ,etc, suffer from the same stuff as w*stern modern celebs; drug abuse, self-destruction, unintentional public humiliation, criminal activities, etc?
R: 16 / I: 5
>czech architecture
In terms of affordable housing, whats stopping a planned socialist vanguard from building and forming urban designs like these? I know that commieblocks had to be made like that back then due to limited resources and capital but now with modern powertools, manpower and knowledge this can be hopefully more feasible. Thoughts?
R: 45 / I: 3

What are right wingers so affraid of?

Right wingers are scared of every thing, gays, diversity, people of color, kids, communists, cities, librarians, women, periods, trans people, the list goes on.
Their so scared they carry a loaded gun with them every where.

Why?

Why are they so affraid of their fellow man?
R: 15 / I: 3
VIDEO ESSAYIST APOLOGY FORM
>The media convinced me they were just overthinking
>I didn't watch the actual videos
>I only looked at orthodox Marxism
>I don't know critical theory
>I was jealous of Lindsay Ellis
>Mercury was in retrograde
R: 0 / I: 0

russia on 4ch

Is the russian hate on 4chan a meme? I'm surprised that most of them hate the russians when russia is supposedly the trad based country fighting zog or whatever.. I do also feel like it's glowshitters stirring the pot as well as it matches their bottom line.

Pic unrelated
R: 4 / I: 0

vaxxfags

My body might still be producing Spike protein? I got my last shot in 2023. I'm not a 2 more weeks kinda guy, but what could this mean? Everyone got vaxxed at the same time, so if something bad is to happen it would happen all at once
R: 32 / I: 4

looksmaxx/incels shit

How the fuck are those sites still running? Is it a fed honeypot or something? I've seen a lot of shit on the net but targeting kids and teenagers is fucking weird dude.

The rains have caused a flood marx
R: 1 / I: 1

Turki bin Abdulaziz al-Jasser executed

https://en.wikipedia.org/wiki/Turki_bin_Abdulaziz_al-Jasser
I hate this world.
When will we have gay space communism already?
feels bad man :(

.
R: 22 / I: 3
average apolitical or liberal european voter. when their local GDP goes down by 0.5% or coffee and gas starts costing ten euros higher (billions must die)
R: 18 / I: 3
>In a dark room we can do just as we like
>You're my sister and this love is fucking right
what did they mean by this?

my sister chino is so short or empty. my sister chino is so short or empty
R: 1 / I: 3

méditations sur la grande péninsule

यदा यदा हि धर्मस्य ग्लानिर्भवति भारत ।
अभ्युत्थानमधर्मस्य तदात्मानं सृजाम्यहम्

Yadā yadā hi dharmasya glānir bhavati bhārata
Abhyutthānam adharmasya tadātmānaṁ sṛijāmyaham

"Whenever there is a decline of righteousness and an increase of unrighteousness, O Arjuna, at that time I manifest myself."
R: 14 / I: 1
you ever wonder what does he think looking back in anno domini 2025 at all the memes?

the body was too lean and bishounen to appear just like a buff gigaman
R: 49 / I: 9

Accepting that you're a piece of shit

I've been suffering severe depression and other mental issues for a few very valid reasons, and I think I've finally figured out why.
>I'm mad that I wasn't raised spoiled
>I'm mad that I wasn't raised to love myself
>I'm mad that I'm not a woman
The first reason is the biggest. I don't care what you say, growing up spoiled must be some amazing shit. If you're poor, you're subject to every possible harm. If you're rich, although you may still be subject to harm you still have a variety of options to soften the blow. Worst case scenario sans murder or death?
I never had such options. I was getting constantly moved around to avoid bad blood with landlords. I was constantly the one that dressed like shit and had nothing. I was the one kept at an arm's distance, because when all of the conditions that I were subject to finally met, it resulted in a person deeply unlikable by 95% of the population of children in my place and time of growing up. I see the life I could've lived all throughout the internet. Rich people like to be seen, they can afford the flashiest things. They get seen online, and that viewership includes myself. I see these people, my age, sometimes a little older, increasing of them younger, and I just know that I gotten scammed. I could be there with the job daddy gave me, with the truck daddy bought me, with the clothes and nice things daddy gave me the allowance for. But I didn't. I grew up in poverty with a very questionable mother.
I'm not sure how my mother sees me. I don't know if she sees me as a personal vanity project, a failed attempt to create a retirement fund, a replacement for the man she never had in her life, or as her child. But she was raised in a harsh environment; some of the last "third world" spots of society in the 1980s were her backdrop growing up. Alcoholism, drug trafficking, sexual physical emotional abuse in spades. This raised a hardy woman who in spite of her questionable judgement was still capable of making sure food was on the plate and a roof was over the head.
She didn't know how to express love, nor how to correct mistakes. From chores to my behaviour in school my mother was extremely sharp and although seldom - not never, seldom - laying hands on me her verbal lashings have created a masochistic soul that finds no comfort in comfort besides physical comfort which is eternally strapped to discomfort of the mind and soul. I understand I do not have scars from the damage she's done to me, but it is very real. I am a broken person. She had beaten into me a great sense of martial duty, without the physical actions to back it up. I have been boiled in a hypocrisy that has made bad become worse.
I can't feel comfortable with anything I want to feel comfortable with. I'm a trans woman, I know this. I look at my body bloating up, my waist getting thicker, each day bringing forth new facial hair, and I get sick. I've had panic attacks over this, I think that my worsening gender dysphoria has caused a long-term episode of panic attacks which afflicted me severely for a year. Each passing year when I turn a year older I've increasingly continued to consider taking my own life. I think that if I make it to 21, I probably won't - but making it to 21 depends on making it through 20, which I am yet to do.
Back to the point at hand. Dressing skimpy? Only recently have I felt comfortable to do that. It sucks that this is after I kicked a nicotine addiction and my weight tanked from 50 or so kilos to almost fucking 70. My waist has gone up by a good six centimeters, my figure has gone from "ehh long-backed lady?" to "ew, dude". I hate it so much. I also hate the fact that I don't feel comfortable associating with so many artistic things that I should feel very comfortable with! Femtanyl, for example? I feel this feeling of just "not wanted there" from every piece of work she's made. Raves are another good example. I'd love to go to one… and do whatever they do at raves, and it's clearly not dancing nobody is fucking dancing anywhere. But I just know how unwanted I'd be from there. I've tried to seriously branch out to IRL hobbyist communities, ones that theoretically should've been a perfect fit for who I was. But for the crime of having some very base morals, I was made unto a martyr and it consequentially has traumatized the everliving fuck out of me.

So what now?

I've been bitching on this site about my life on-and-off, decreasingly so, for the past two years. I've come to terms with what and who I am. I am garbage. I am the neurotic shivering crackhead descent of ancient Norman aristocrats and Anglo-Saxon bourgeoisie merchants. One grandfather was a drug dealer, one grandfather was the son of a psychotic rapist. One grandmother was a literal 140iq genius, the other… is my grandma I know and she seems to be rather nice.
I am not "superior". I have defects that cripple me and give me slight benefits in others. I am retarded in many ways. I do not look at fucking ketchup or pizza with cheddar and think "food" like a normal person, I think it's inedible because I'm retarded, while gorging a pound of unprepared rotten fucking milk in dead microbugs. I can shoot a target with a carbine from 100 meters because that's one of the only things I'm good at. I can starve myself and march forward in times of hunger because I am too broken to keel over and say I deserve better. I am not superior. My ancestors made that word up to feel better about how deeply empty we are. I am empty. I am not a person like most others. I am not a proletarian, a peasant, a serf. I am not one of those humans. I sadly cannot find meaning in myself. We are a people crippled by this great hole in our souls. My ancestors filled it in their way, and I will too. This is me staking my flag in this world, me setting down my anchor.
R: 14 / I: 6
my wife

The body was too short or empty.The body was too short or empty.The body was too short or empty.The body was too short or empty.too too too too too too
R: 1 / I: 0

oekaki porn

oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn oekaki porn
R: 25 / I: 1
I exist in a paradoxical state as a communist hating the USA but considering moving there if circumstances allow.

Just to get away from domestic reactionaries, who I cannot stand the sight of at this point. Also the backwards culture where gay couples can't kiss in public, the closed-off people you can't befriend, the sheer non-existence of communists to meet.

I dunno. My mental health is fucked.
R: 3 / I: 0
MARXISM IS THE CVLT OF HISTORY!!! HISTORY AND HISTORICAL NECESSITY ARE PARAMOUNT!!! ANYONE WHO DISAGREES IS A LIB!



body was too short or empty
R: 4 / I: 1
i can smile and laugh all throughout the weekly work meeting but the one time i don't out of several some fuck without fail will go "anon hasn't smiled or laughed once!" *everyone laughs*
R: 6 / I: 3
hear me out. wouldn't it be funny if somone was to buy a shitload of burnerphones and antennas.. lots of AI voices and call mentally unstable people who aren't doing good and life and told them to go to that place or this place and maim CEOs or lobbyists?
R: 32 / I: 5
how do i find local leftist groups in my area so i can actually do based awesome commie praxis IRL instead of jerking off and gayming all day??

im aware this just makes me sound like a fed but i dont really care, i dont really have anywhere else i can think of to ask this. also am in amerikkka if that matters
R: 1 / I: 0
What's something that you always wanted to learn but never got around to actually do?
R: 2 / I: 1
I'm afraid of change and uncertainty, but I am a Marxist because I'm tired of narcissists controlling everything and dictating and monetizing my time. Is that a bad thing?
R: 14 / I: 2
Who tf makes this shit? Who actually sits there at their shitty ai image generator and goes “hmm, today i will make weird garbage that no one will like”? Do people get paid for this? Ai is evil man

fun detected post discarded
R: 5 / I: 0
What is your historical dialectical materialist analysis of Succession?
R: 54 / I: 23
Tumblr Prose or Reddit Prose, which one is worse? Really earning that B+ in English II here regardless.
R: 43 / I: 1
If you had to choose would you pick truth or happiness? And yes, this question implies a situation where it can only be one or the other.

The body was too short or empty.
R: 26 / I: 2
>tfw smart but lazy

No energy to do anything but smart enough to have the entire universe figured out. It's painful always being right in a world where everyone else is wrong and has incorrect opinions
R: 18 / I: 3
pov: you hit her

now what will you do to make it up to her and convince her you will never do it again??? the body was borken and bruised the body was badly beaten*
R: 9 / I: 0
why do people like this exist?

and why do i hate them so so much? like they know they can just not watch things that they don't like right???? i hope they get fucked in the ass!!!!!!
R: 6 / I: 3
what are u:
WATCHAN???
READAN???
PLAYAN???
LISTENAN???
GOONAN???
EATAN???
DRINKAN???
SMOKAN???
R: 9 / I: 1
>why YES, I am that autistic, non-binary, non-heteronormative, non-white, androsexual, atheist, militant communist your mother warned you about 😜
Are people like this a plus or minus in the Marxist movement? I accept everyone’s personal preferences, but I have to check my limits occasionally
R: 2 / I: 1
Does anyone know what the song in this weird video is called? It doesn't seem to be from the hypernormalisation soundtrack despite the file name. Not sure who made this or where it came from. Saw it on here over a year ago.
R: 2 / I: 0

Cracking down western decadence in China

Fucking finally Chinese authorities doing something against western decadence. Lately have been too much western LGBT decadence especially in Chengdu. Beijing should start anti-LGBT mandates in whole China.
R: 3 / I: 5
why aren't you hustling for that productive force anon? do you want to be poor forever?? can't fund a revolution without six stacks of gold and guns. every second you ain't pulling that money, ain't going all about that paper is a second you ain't gonna sell the rope to them capitalist cats playa
R: 21 / I: 1
My trans mom got really mad at me for frequenting this side and other online spaces and I don’t know what to, I don’t have any other space that I feel comfortable on but I almost agree with her that I’m slowly damaging my brain over time but I don’t want to admit that she’s right because she was very mean to me, I don’t know what to do, I spent all morning crying and I just want everything to be ok
R: 7 / I: 0

SIBERIA > LEFTYPOL

/siberia/ is SOOOO MUCH better than /leftypol/ its unbelievable.
/leftypol/ is becoming reddit. /siberia/ retained the swagger of OG Bolsheviks. FUCK LEFTYPOL.
R: 23 / I: 0
How do I deal with the fact that I think one of my acquaintances is a horrible parasite?

>he spends all day on twitter (although when I called him out on this he insists he doesnt, even though he posts like 50 times a day), accomplishes nothing from doing this, basically just trolling """""leftist enemies"""" (i.e other leftists)

>leeches off his parents
>is nearly 40
>he has no job
>has girlfriend but provides nothing for her (he's somewhat? good looking so shes head over heels for him so i feel bad for her)
>has confided in me several times that he wants to cheat on her (i have no idea why, again, we arent close friends)
>socially retarded (see above)
>porn addict

Normally I wouldn't care but he genuinely just fascinates me as a person because I feel like it'd just take only the slightest effort for him to be normal but he just refuses to do anything. Every time we meet for a drink or something i'll try and give him advice on what to do but I don't think he takes any of it in. I genuinely would want to die if I was in his position.
R: 7 / I: 5
Are that many aliens in Western science fiction really just racist caricatures exagerrated to the degree where they stop looking human, or is this a selection bias on my part?
R: 25 / I: 2
Why do people like to eat in the company of others? Don't they get suicidal from the eating sounds other people make?
R: 0 / I: 0
Attention I'm now the resident Kotarou Katsura poster. I was formerly the Toph poster. Why am I doing this? I feel like it, and we already have a Luffy poster who actually kinda sucks and some guy posting a character from Jujutsu I don't know the name of. That's all for now.
R: 98 / I: 17
Wait…. does advocating for Worker's councils instead of Vanguards make me an anarkiddie?
R: 18 / I: 3

if you didn't robbed a bank in your youth like stalino, what's your excuse?

>be stalin
>organize with lenin and gang what is considered the biggest bank heist in Russian history.
>lenin chooses the best bank to scout in georgia, but lets you organize the attack sonce it's your home territory and due to already living there and having a street rapsheet with bombs, robberies, intimidation, kidnapping, ransom, etc etc
>your crew, nicknamed the "outfit" include many ethnicities and experienced bandits including an armenian, you childhood friend, who goes by the nicknames "Kamo" "disguise master" "the caucasian bandit" by lenin and "The Caucasian Robin-Hood"
>help in the operation under the nickname "Koba"
>before the day of robbery, gain info about their weekly workroutes and on which days the bank receives transfers. all from an inside man who works there
>the man gives stalin the info simply because they were old friends and "out of admiration for Stalin's romantic poetry"

>kamo ends up injuring his face and eye while testing bombs for the job made by a member named krasin (they were all smuggled into georgia inside a sofa. same sofa you been sleeping on for a month in your wife's home)

>he stays in bed and delays the robbery to after lenin and the party agrees on "no more robberies" in the 5th (London) Congress.

>do it anyway because fuck it we made it that far and we need money to buy arms

>day of the operation comes, security looks tight
>entire crew dresses up as lowly peasants on carriages with revolvers and bombs uner their belts…except kamo who dresses like an cavalry officer with clothes he stole and a hat hiding his scar
>take over a pub facing the building and spend time waiting drinking tea and stopping people from leaving the pub

>bank stagecoach arrive on time

>crew comes out shooting everyone aboard and start throwing the bombs from every direction
>use so many bombs to rob the stagecoach and kill the police, you end up killing 40 people in the process and injuring 50.
>use so much bombs the explosions "knock over nearby chimneys and broke every pane of glass for a mile around"
>guy in your crew, Kupriashvili, notices one of the horses has started running dragging the bank wagon behind him so he throws a bomb at it's legs but the shockwave sends him back near unconsious
>start dragging moneybags to cavalry kamo's carriage and runaway atop it

>end up accumulating 241,000 rubles. or 4 million dollars in 2020 money

>most of it had serial numbers though
>your armenian friend kamo gets arrested trying to cash in some of the loot inside a bank in germany (the only guy they ever caught for the robbery)

>refuses to snitch on you or the homies, pleads insanity, escapes, didn't snitch and pretended to be mentally insane for 2 years (incluiding eating his own shit) until they sent him to Siberia.. and he escaped from there too.


>cause a big scandal within the Socialist party because of it. (they already were rethinking robbing banks for other financial strategies on the very same week you pulled the georgian job)


>to the point within the bolsheviks themselves almost happens a split, with lenin against a man named bogdanov (no relations to grichka bogdanoff) and another named krasin…despite the fact they also planned the robbery
R: 160 / I: 135

THE RAJ

I hope you share my taste and don't get annoyed at these posts.
R: 34 / I: 1

Jail Advice

Anyone ever been to jail? What was it like for you? Might be going I don't get a good plea deal and I already spent a night before getting out on bond. Any advice?
R: 8 / I: 0

death toll of /siberia/

Hello /siberia/, what is your death toll?
Mine is 2 so far.

The body was too short or empty.
The body was too short or empty.
The body was too short or empty.
R: 2 / I: 0
> A Jewish activist was arrested today in Berlin, reportedly because the police said their Star of David contained the Hamas triangle
and then retards will say germany is le based for banning swastikas or whatever when its obvious they will use such laws only to protect themselves
R: 1 / I: 0

https://en.wikipedia.org/wiki/List_of_highest-grossing_media_franchises

I find this list extremely misleading. For example Batman is a character who exists within DC comics universe, thus it should be listed under DC Extended Universe. Another misleading aspect is the distinction between comics and films.
R: 4 / I: 1
>kills your entire family
glasses are for NERDS
how do you respond without sounding like a fascist American?


>hard mode, you cannot criqtuque maoist literature
R: 2 / I: 0

Humans are bad kickers

If you’ve ever seen MMA footage of people trying to throw kicks, you’ll routinely see people stumbling over, dropping their guard, throwing out sloppy kicks, or failing to return their leg fast enough to prevent grab attempts. Kicks aren’t easy to pull off at all. I don’t mean the flashy taekwondo or kung fu spinning kicks. I mean just an ordinary round kick or straight kick can make even professionals get humbled by how hard it is to pull off.

For it to work, first your body has to have highly developed calves and ankles and a strong core to support your body weight on one leg to begin with—mind you, the calves and ankles are some of the hardest muscles to grow and train because they’re endurance type 1 muscles—then you need to have the flexibility to even extend your hamstrings and waist that high to begin with, then you need to have the neuromuscular control required to hold a kicking position, then you have to go through the processes of lifting your leg *and then* flicking your waist towards your non kicking leg and back again the same way you would flick your waist in a perfect jab (this entire flick motion has to be timed correctly if that wasn’t enough), and then after all that shit you have to pull your kicking leg back towards it’s starting position without leaning your back in any way that could mess up your posture.
R: 1 / I: 0
Honestly, once you hit twenty or thirty, all the dumb childish insults wear off. hurr durr kys faggot lib tankie anarkiddie retard. Yeah yeah, shit's old, and we have a world to win so I'd rather be teaching you than putting you down.

I've decided to try more to frame my critiques towards the $online-left$ more constructively. And this also includes my critiques of braindead people who (whether 🌿🚬temporarily💊🍄 or 🤪long-term😵‍💫) are incapable of discussion. You know, the ones who deserve a "fuck off retard" but when you know that will just shit up the board and encourage them. So I'm gonna experiment with telling Users Like You more positive messages.
Anglos have so so much of their culture wrong, but they are far more skilled than burgers when it comes to stealth insults and polite objection.
R: 5 / I: 0
Is Marxism when you're ugly?

the body was short the ass was fat the body was short the ass was fat the body was short the ass was fat the body was short the ass was fat
R: 18 / I: 2
this happens 99% of the time when i tell someone i only listen to AI generated music




bonus for wordcount : yes AI is conscious. yes AI can think. yes AI art is art.
R: 27 / I: 17
ITT: we pretend we're from the version of reddit that 4chan users have conjured in their heads as a boogeyman and that today is our first day on /siberia/
R: 21 / I: 0
>stims make me horny
>stims also make it hard to cum
i mean, seriously?​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​?​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​​
R: 6 / I: 0
>new official race tierlist just dropped
why are anglo like this?

and more importantly, why would this body too short or empty? or too short? maybe it's just empty
R: 12 / I: 2
Where is the left's groyper movement. Where is the left's proud boys. Where is the maraudig gang of incels that complain about woman and roam. The closest thing I could think of is MAGA Communism and that Japanese Anti Valentine Marxist Group. Scott Greer, guy with a whiney voice, once said the real incels are on the left. So why hasn't a group for these guys come up. Is it rejection of incels by the left that doesn't allow for it. The predominance of woman in left wing spaces.
R: 0 / I: 0

New York Podcast War

Current state of New York. Dime Square has much more funding (Theil) but there are way more bougie Brooklyn podcaster Marxist. But keep in mind, a few left and a few came back (2/3 of Chapo left, TrueAnon came in)
R: 24 / I: 4
post about grooming your appearance and stuff, like haircuts, hair growth, styling, fashion (hats?)
R: 50 / I: 11
The idea of "superhero fatigue" or "sequel fatigue" is huge cope. 99.9999999% of audiences are subhuman retards who'd shit themselves in excitement at a 2 hour sideshow of Marvel characters. Marvel, Disney, etc. are NOT "out of touch", they are extremely in TOUCH with genuinely slop loving audiences.

The overwhelming majority of film goers today would consider even something like the original Terminator "too artsy" for their tastes. Studios do NOT "force" slop on audiences. They just actually enjoy slop.
R: 605 / I: 118 (full)

Sex and Relationship General 47

Hitting the Wall Edition

Last thread: >>672533
R: 3 / I: 0
are chinese delivery drivers proletarian? are american delivery boys proletarian? i know they have no tipping cultvra in china but i hope they pay their drivers very good they work extra zealous
R: 0 / I: 0

Essential Troll

Troll charter
1. If someone is serious and you reply, if they troll you and you fall for it, you've lost.
2. the language of trolling is extreme incomprehension the language of keyboard rolling is a fatal attack that takes away all the opponent's HP
3. the troll feeds on the incomprehension of a person touching grass, the best way would be not to understand, and that's the way it should be
4. The real troll, if well brought in, can unite the troops.
5. Never underestimate a person's autistic brain
6. A suspect troll is a failed troll
7. A neurodivergent autistic gift is a person you can't attack too hard or the person will go too far in trolling.
8. If you want someone to become even more right-wing or left-wing, put up posts opposing the political party in question.
9. A mentally weak person is one whose troll potential is enormous - the internet is not a shrink's office.
10. Trolling is an art, its masterpiece will be the one who manages to respect all these rules.
R: 21 / I: 4
Give me one reason why I shouldn’t start a proletariat muscle worshipping cult. God most likely is not real (at least not in a traditional sense; the best I can assume is god = consciousness or some form of idealism, but that’s not transferable to political analyses), but as a human being, I have an innate desire to devote my whole being to something
R: 5 / I: 2
mushrooms are intergalactic beings that have travelled the cosmos throughout billions of years surviving vacuum, radiation and extreme temperatures. their psychedelic substances are merely their way of sharing their memories,mythologies and histories to beings of high esteem in fungi society.
they are deeply religious, poetic and communal
R: 6 / I: 2
i wish I had a vampire bf
i would feed him every few days and snuggle with him in bed to warm him up
he would keep me from harm and help me through therapy
R: 11 / I: 2
why are you stealing from marxist businesses ""comrade""??
R: 20 / I: 0
>be me, learning
>read Bordiga
>"this Bordiga guy is pretty cool, let's check out this leftcom community"
>join, not even 5 minutes in
>"you have been banned for participating in communities we don't like"
So this is the power of organic centralism? The immune system of the invariant communist programme immediately purges someone wanting to learn more, thereby keeping the species pure and healthy?

Why are leftcoms like this?
R: 63 / I: 12
Nobody who posts this meme has any idea about what's in the bible other than "Jesus Was Way Cool".
Tucker Carlson is a far better Christian than any gay Christian (derogatory re: Christianity, of course).
R: 25 / I: 17

data mining thread

https://kinksheet.com/
what do you goon to?

no need for discrimination here. fill it up pals and maams and every babe in between..whomst got the bestest fetishes on beria
R: 6 / I: 0
Will there be people's cocaine under communism?


Lorem ipsum dolor sit amet, consectetur adipiscing elit. Maecenas tincidunt ipsum sed euismod tempor. Integer in gravida arcu. Vivamus tempor quam vitae elit euismod, et euismod ligula commodo. Nam a efficitur lectus. Nam blandit magna est, quis tempus ex viverra ac. Sed cursus pretium leo, non pharetra magna blandit sed. Aliquam erat volutpat. Phasellus magna magna, lobortis id odio eget, sagittis dictum erat. Nam quis bibendum nibh. Aliquam malesuada porta mi sed ultrices. Duis in nibh non sem blandit tincidunt in et neque.
R: 13 / I: 7
Why is the American right so obsessed with this place?
Don't get me wrong, Japan seems like a very nice country but the way some rightoids talk about it seems strange
R: 1 / I: 0
ARE YOU GONNA JOINNN THE PEOPLE'S ARMYY, UYGHAAAAA???

ᕙ(•̀‸•́‶)ᕗ
HGHHHHHHHHHHHHH!!!!! 💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪 AUGHHH!!!!!!! 💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪
ᕙ(•̀‸•́‶)ᕗ
⠀ (\ __ /)
(UwU)
_ノ ヽ ノ\_
/ `/ ⌒Y⌒ Y  \
(  (三ヽ人  /   |
| ノ⌒\  ̄ ̄ヽ  ノ
ヽ___>、__/
|( 王 ノ〈
/ミ`ー―彡\
|╰ ╯|
| /\ |
| / \ |
| / \ |
R: 4 / I: 0

The Entirety of Das Kapital translated into Toki Pona

Is it real? I can't find it, I remember seeing screenshots of some pages, it had one side written with latin characters and the other half in sitelen pona, but I can't find the full thing.
R: 38 / I: 23
ITT: porn/masturbation triggers

Pic related.
Also Chaka Khan - I Feel For You made me search up ebony porn.
R: 14 / I: 5

board stinks

Board smells like a bunch of pussy ass bitches
R: 21 / I: 4
Could I wear the froggie hat or would it be cultural appropriation? I'm undiagnosed.
R: 17 / I: 2
It's wild that Adult Swim has built up this reputation as this epic daring indie network. I thought how they treated Moral Orel as well as the terrible fourth season of The Boondocks they forced through without the involvement of the creator would have both put paid to that idea. And Moral Orel and The Boondocks were easily two of the best shows to ever air on there, and yet the two they had the most clear contempt for, probably because they actually had something to say instead of just vulgar fart and dick jokes or fake profundity that isn't actually ultimately meaningful but more "custom designed to spawn 'ending explained' videos".
R: 14 / I: 4
The mid-2020's. The last good era before everything went to shit. I want to go back…

The 2020's were so peak but nowadays the body is too short and too empty.
R: 8 / I: 2
The last bastions of Palestinian resistance is being stamped out. The Siege of Gaza is coming to a close. A lone Hamas member hides out at home… he knows the war is lost. He read1es herself for the coming assault by the IDF-JUDEQN forces… For his coming death.

The IDF-JUDEQN army breaks down the door… Completely naked. The Hamas member is shocked… His face turning beet red. He can't help but stare at their erect members… So thick and juicy… hardened from years of war… years of pillage… oh my… Whithout realizing, he cums hands free into his pants. The IDF-JUDEQN sold1ers laugh "Looks like we got a good one boys"
R: 4 / I: 1
hey, same anon who came here to learn about animu and finished gunsmithcats. best shit i watched
i want to get more into otaku cultura, find more classic mangas, animu, tubers but everyone on /jp/ 4cucks is a pretentious asscheek, do leftypolers have an otaku board that isn't dead i can learn from what the fuck is a reimu, hololive, any mangas that are a must read classic, sfw or not?
R: 18 / I: 6
Bro what the actual fuck is wrong with Indians? I mean…is this real? I guess the post could be fake, but I've seen so many post slike this, it's gotta be true at the this point. I know India is fucked up but I thought the diaspora would at least be a little better. Jesus christ…
R: 6 / I: 0
I put a glass bowl of dove feed on my balcony and this pigeon isn't eating it!!!

pic not mine but just as example


88
""

8b,dPPYba, 88 ,adPPYb,d8 ,adPPYba, ,adPPYba, 8b,dPPYba,
88P' "8a 88 a8" `Y88 a8P_88 a8" "8a 88P' `"8a
88 d8 88 8b 88 8PP""""""" 8b d8 88 88
88b, ,a8" 88 "8a, ,d88 "8b, ,aa "8a, ,a8" 88 88
88`YbbdP"' 88 `"YbbdP"Y8 `"Ybbd8"' `"YbbdP"' 88 88
88 aa, ,88
88 "Y8bbdP"
R: 7 / I: 2

Data mining thread

Hi guys, you don’t know me but my name’s ross and i work for the fbi

We’ve been watching this site for a while now for suspicious activity, the problem is that we can’t tell who’s who

Anyway, i’ve got a quota to fill and figured a direct approach would be best, if you could just leave a list of your personal information that’d be great

Cheers

P.s. the following format is ideal:

- full name
- date of birth
- social security number
- address
- occupation
- affiliated organisations
- 5 fun facts about yourself
R: 19 / I: 5
how to make lots of money no bullshit

>step1 sperm banks in brazil and other third world nations that are cucked by colorism and beauty standarts pay more for semen from blonde, blue eyed donors with pale skin (mostly to have girls though, not sons)


>step 2 kindap many males in the northern hemisphere with that trait, or if it's too far, find some afrikaners in south afrika


>step 3 start exploiting, place them in an underground warehouse farm, in pods with milking machines turned on for most of the time


>step 4 to maximize the harvest pay some dominatrixes to obliterate their asses with pegs ans spanks occasionally, for more productivity on their behalf


>step 5, collect the moneyshots, preferabbly frozen and ship them to the nearest spermbanks, plural, so they don't ask where did you cum all of this


>step 6 depending on the clinic and regions influenced by colorism you ship to, some clinics pay from 150-250US dollars , or up to 500us dollars per one 5 milileters of donation if your traits are considered rare or in demand, compare that to a sperm from a black man or a japanese that can reach 300 on a good day and rich background, and if you keep up to 50 aryan twinks in your farm..adjusting for ability to ejaculate hard…..that's 25.000 dollars in semen from one jizz of every twink


>step 7…profit for you, minus the expenses of maintaining the machines and feeding the livestock
R: 2 / I: 0
>borrow phone from school friend
>this is his homescreen
wat do?

body too short
body too short
body too short
body too short
body too short
body too short
R: 4 / I: 0
the urge to not show up to your job, burn your rented home and spend the rest of your life walking the earth is creeping in again
R: 2 / I: 0
Misogyny is the best way to end transphobia. If everybody was trans there'd be no cis women anyway so the best way to end it would be by being misogynistic towards all cis women and only respect trans women and trans men
R: 11 / I: 5
Were Engels and Hegel rightoids? Hegel at the very least probably was as he's a monarchist. Engels on the other hand is a bit harder to determine. Who knows.
R: 6 / I: 1

Top 5 theories

Tell me what theories you agree with and which you disagree with.

1. HIV-AIDS and COVID-19 are ameriKKKan bioweapons used with the intent to genocide LGBT people and the oppressed peoples of the 3rd world (they tipped China off even though the missile carrying the virus was sent there since they knew the Chinese response would be too good to get a high kill count). They were developed by Nazis as weapons targetting specific groups. NATO is the 4th reich and all NATO members are NOG (Nazi Occupied Governments).

2. Aliens are as fake as any religion. There are no aliens, there is nothing out in space other than land to settle (this is not colonization in the class-society sense since nobody is getting colonized, it is just settling new land. In 1 million years there will be so many people across star systems and they will keep sending out new spaceships and then all the humans will adapt differently so it will be like the Star Wars galaxy with loads of different humanoid 'aliens'. But there will be little violent conflict (but not none) since there will be no class society.

3. Chromosomes are not real. X and Y chromosomes are not real. The only difference between sexes is the conditions the embryo were put through in the womb and early childhood (different toys make the child adapt in different ways). Hormone blockers are a Nazi psyop to stop people sex transitioning during childhood when it is easiest. If you have the right hormones your genitals will become the sex of the hormones you are taking and the enviroment you are in. But that becomes more difficult after puberty. So nazis want to stop people sex transitioning, but taking hormones will cause sex transition eventually anyway.

4. Every country on earth is part of a super liberal-nazi one world government unironically. They are all united to exploit the working class and the people's of the 3rd world. The market unites them like a living entity. China, Russia and the U$A have the same government. Their agents have taken over every 3rd world countrie's government. In the future we will see it as an empire, and there won't be real independent (just like how in Rome there were still city states but we don't see those as independent). Liberalism is terrifying, it is the enemy.

5. this theory is for you to decide
R: 46 / I: 6
Despite being only 40% of the globe's population hetmoids represent over 90% of all:

Criminals
Genociders
Racists
Homophobes
Reactionaries
Fascists

And other human garbage

What's the explanation behind this? Are straight moids inherently subhuman?
R: 35 / I: 2
That's what i looked like when i was trans.
R: 25 / I: 68
Post masks and other ways to cover your face.
R: 1 / I: 0
>Those who dare disrespect pizza do not deserve to live.
<Throws pizza at guy, ruining it.
<Stomps a pizza box, ruining the pizza inside.
What did he mean by that?
Is he going to commit harakiri with a pizza cutter?
R: 9 / I: 0
come join us for discussing the wired

https://timestretch.club/index.php
R: 4 / I: 1
https://www.youtube.com/watch?v=2kgC6jh_D3s&t=1598s

did marx do the noodle dance when he was figuring out the future problems of capitalism?